KEGG   Miniopterus natalensis: 107544520
Entry
107544520         CDS       T05883                                 

Gene name
CHRM2
Definition
(RefSeq) muscarinic acetylcholine receptor M2
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04725  Cholinergic synapse
mna04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107544520 (CHRM2)
   04024 cAMP signaling pathway
    107544520 (CHRM2)
   04151 PI3K-Akt signaling pathway
    107544520 (CHRM2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107544520 (CHRM2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107544520 (CHRM2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107544520 (CHRM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107544520 (CHRM2)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107544520 (CHRM2)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 107544520
NCBI-ProteinID: XP_016077906
LinkDB
Position
Unknown
AA seq 466 aa
MNDSTNSSSDGLALSSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVRRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVKDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDRKEPAANQDPVSPSLVQGRI
VKPNNNNTPGSDDGLGHSKMQNGKAPRDAVTDNCVPADDKESSNDSTSVSAVASNMREDE
VTQDENTVSTSLGYSKEESSKQTCIKIVTKAQKGDSCAPTNTTVELVGPPGQNGDEKQNT
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaatgactcgaccaactcctccagcgatggcttggctctgagcagcccctataagaca
tttgaagtggtgtttatcgtcctcgtggccgggtccctcagtttggtgaccatcatcggg
aacatcctggtcatggtgtccattaaagtcaaccgccacctgcagaccgtcaacaattac
tttctgttcagcctggcctgcgccgacctcatcatcggcgtcttctccatgaacctgtac
acgctctacacggtgatcggctactggcccttggggcccgtggtgtgcgacctgtggctc
gccctggactatgtggtcagcaacgcctcggtgatgaacctgctcatcatcagcttcgac
aggtacttctgcgtcaccaaaccgctcacctaccctgtcaggcggaccacgaaaatggcc
gggatgatgatcgcggccgcctgggtcctgtccttcatcctctgggctccggccatcctc
ttctggcagttcattgtgggcgtgaggaccgtgaaggacggcgagtgctacatccagttt
ttttccaacgccgctgtcaccttcggcacggccatcgccgccttctacttgccggtgatc
atcatgaccgtgctctactggcacatatcccgagccagcaagagcaggatcaagaaggac
agaaaggagcctgcggccaaccaggatccggtgtccccgagcctggtccaagggcggatc
gtgaagcccaacaacaacaacactccgggcagcgacgatggcctggggcacagcaaaatg
cagaacggcaaagccccccgggatgccgtgactgacaactgtgtccccgccgacgacaag
gaaagctccaatgactccacctccgtcagcgccgtcgcctccaacatgagagaggacgag
gtgacccaggatgaaaacacagtgtctacttccctgggctattccaaagaggagagctcc
aagcagacttgcatcaaaatcgtcaccaaggcccagaaaggtgactcatgcgccccgacg
aataccaccgtggagctggttggtcccccgggtcagaatggagatgaaaaacagaacact
gtggcccgcaagattgtcaagatgactaagcagcctgcaaagaagaagccccccccttcc
cgggaaaagaaagtgaccaggacgatcttggccatcctgttggctttcatcatcacgtgg
gccccctacaacgtcatggtgcttattaacaccttctgcgcgccctgcatccccaacacc
gtgtggaccatcggctactggctctgttacatcaacagcaccatcaaccccgcctgctat
gccctctgcaacgccaccttcaagaagacctttaaacacctcctcatgtgtcactacaag
aacataggcgccacaaggtaa

DBGET integrated database retrieval system