KEGG   Miniopterus natalensis: 107544687
Entry
107544687         CDS       T05883                                 

Gene name
GMPS
Definition
(RefSeq) GMP synthase [glutamine-hydrolyzing]
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
Module
mna_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107544687 (GMPS)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107544687 (GMPS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107544687 (GMPS)
Enzymes [BR:mna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     107544687 (GMPS)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   107544687 (GMPS)
SSDB
Motif
Pfam: GATase GMP_synt_C Peptidase_C26 NAD_synthase QueC tRNA_Me_trans ATP_bind_3 Asn_synthase PAPS_reduct ThiI Arginosuc_synth
Other DBs
NCBI-GeneID: 107544687
NCBI-ProteinID: XP_016078083
LinkDB
Position
Unknown
AA seq 843 aa
MPGLSLLDPSSLRSKAAALNQVSTVLRGSQGAGGLGYFLLRLRVLKPGARPLAGHPGDGH
VGAPWSGVKEAEEAPRAAAPGLGLENGAVVPRWKPAPNCGETERPASDRPPVTPQNSRQR
VTSRPALQEVVLGSNKSRPRLPSKPIRTRSRGPAGQPRQLENAGGDIKDGCHHYEGAVVI
LDAGAQYGKVIDRRVRELFVQSELFPLETPAFAIKEHGFRAIIISGGPNSVYAEDAPWFD
PAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFSISVDNTCSLFRGLQKEEIVL
LTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGVQFHPEVGLTENGKAILKNFLYDI
AGCSGTFTVQNRELECIREIKERVGTSKVLVLLSGGVDSTVCTALLNRALNQDQVIAVHI
DNGFMRKRESQSVEEALKKLGIQVKVINAAHSFYNGTTTLPISDEDRTPRKRISKTLNMT
TSPEEKRKIIGDTFVKIANEVIGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKT
HHNDTELIRKLREEGKVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICA
EEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACTTEEDQEKLMQITSLHSLNAF
LLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNINRVVYIFGPPVKE
PPTDVTPTFLTTGVLSTLRQADFEAQNILRESGYAGKISQMPVILTPLHFDRDPLQKQPS
CQRSVVIRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTT
EWE
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgccggggctgagcctcttggatccgtctagtctgaggtccaaggctgccgctctgaac
caggtctcgacggttctgagagggagtcagggcgcgggagggctcgggtacttcttactg
cggctcagagtgctgaagcccggagccaggcccctggctggacacccaggcgacggccac
gtaggtgccccttggagcggcgtcaaggaggctgaagaagccccccgggcagccgcgccg
ggcttggggctggagaacggggccgtggtgccaagatggaaaccggcgcctaactgcggc
gaaactgaacggccggcctccgaccgacccccagttactccacagaactccaggcagcgg
gtaacctcccgccccgcgcttcaggaagtggtcctgggctcaaataagtcccgtccccgc
cttccgagcaagccaatcaggacacgctcccggggcccggctgggcaaccacgccagctg
gagaatgctgggggagacattaaggatggctgccaccactatgaaggagctgtggtcatt
ttggatgctggtgctcagtacgggaaagtcatagaccgaagagtgagggaactgtttgtt
cagtctgaactctttcccttggaaacaccagcatttgctataaaagagcatggattccgg
gctattatcatctctggaggacctaattctgtgtatgcagaagatgctccctggttcgat
ccggcgatattcactatcggcaagcctgttcttggaatttgctatggcatgcagatgatg
aataaagtatttggaggtactgtgcacaaaaaaagtgttagagaagatggagtcttcagt
attagtgtggataacacatgttcgttgttcaggggccttcagaaggaagaaattgttttg
cttacccatggagatagtgtagacaaagtagctgatggattcaaggttgtggcacgttct
gggaacattgtggcaggtatagcaaatgaatctaaaaaattatatggagtccagttccac
cctgaagttggccttacagaaaatgggaaagcaatcctgaagaacttcctctatgatata
gctgggtgcagtgggaccttcactgtgcagaacagagaacttgagtgcattcgagagatc
aaagagagagtaggcacatcaaaagttttggttttgctcagtggtggagtagactcaaca
gtttgtacagctttgctgaatcgtgctttgaaccaagatcaggtcattgctgtgcacatt
gataatggctttatgagaaaacgagaaagccagtctgtagaagaggccctcaaaaaactt
ggaattcaggtcaaagtgataaatgctgctcattctttctacaatggaacaacaactcta
ccaatatcagatgaagacagaactccacgaaaaagaattagtaaaacgttaaatatgact
acaagtcctgaggagaaaagaaaaatcattggagatacttttgttaagattgccaatgaa
gtaattggagaaatgaacctgaaacctgaggaggttttccttgctcaaggtactttacgg
cctgatctaattgaaagtgcatcccttgttgcaagtggcaaagctgaactcatcaaaacc
catcacaatgacacagagcttatcagaaagttgagagaagagggaaaagtaatagaacct
ctgaaagattttcataaagatgaagtacgaattttaggcagagaacttggacttccagaa
gagttggtttccagacatccatttccgggtcctggcctggcaatcagagtaatatgtgct
gaagaaccttatatttgtaaagactttcctgaaaccaacaatattttgaaaatagtagct
gatttctctgcaagtgttaaaaagccacataccctattacaaagagtcaaagcctgcaca
acagaagaggaccaggagaagctgatgcagattacaagtctgcattcactgaatgccttc
ctgctgccgattaaaactgtaggtgtgcagggtgattgtcgttcctacagttatgtgtgt
ggaatctccagtaaagatgagcctgactgggaatctcttattttcctggctcggcttata
cctcgcatgtgtcacaatattaacagagttgtctatatatttggcccaccagttaaagag
cctcctacagatgttactcccaccttcttgacaacaggggtgctcagtactttacgccaa
gctgattttgaggctcagaacattctcagggagtctgggtatgctggaaaaatcagccag
atgccagtgattttgacaccattacattttgatcgggacccacttcagaagcagccttca
tgccagagatctgtggttattcgaacctttattactagtgatttcatgactggtatacct
gcaacacctggcaatgagatccctgtagaggtggtgttaaagatggtcactgagattaag
aagattcctggtatttctcgaattatgtatgacttaacatcaaagcccccaggaactact
gagtgggagtaa

DBGET integrated database retrieval system