KEGG   Miniopterus natalensis: 107544719
Entry
107544719         CDS       T05883                                 

Gene name
GABBR1
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 1
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04727  GABAergic synapse
mna04742  Taste transduction
mna04915  Estrogen signaling pathway
mna04929  GnRH secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107544719 (GABBR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107544719 (GABBR1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107544719 (GABBR1)
   04915 Estrogen signaling pathway
    107544719 (GABBR1)
  09156 Nervous system
   04727 GABAergic synapse
    107544719 (GABBR1)
  09157 Sensory system
   04742 Taste transduction
    107544719 (GABBR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107544719 (GABBR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107544719 (GABBR1)
G protein-coupled receptors [BR:mna04030]
 Metabotropic glutamate receptor family
  GABA
   107544719 (GABBR1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 Sushi UPF0242
Other DBs
NCBI-GeneID: 107544719
NCBI-ProteinID: XP_016078119
LinkDB
Position
Unknown
AA seq 978 aa
PRSPAGPRATPQPPGRGCRLCLFRLPPSFLLLGALPSGCQIIHPPWEGGIRYRGLTRDQV
KAISFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLMLENGK
VFLTGGDLPALDGARVDFRCDPDFHLVGGSRSICSQGQWSSPKPHCQGEGNSLPESLSPQ
CDPGQATKYLYELLYNDPIKIIVMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQR
FPTFFRTHPSATLHNPTRVKLFQKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITF
RQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADN
WFKTYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPE
ETGGFQEAPLAYDAIWALALALNKTSGAGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFE
GVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWWKTDKWIGGSPPADQTL
VIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNAHVRYIQNSQPNLNNLTAVGCSL
ALAAVFPLGLDGYHIGRHQFPFVCQVRGAGGTPGNVSGPPVRGTVRAHWSLPASPAAGLW
PRSAPSLFPHLPASIPGLAASSLQTPGLRGLPGSPRVCVGRSRLRGVGWPVCGETRGAAV
TLEPWKLYATVGLLVAMDVLTLAVWQTVDPLHRTVETFAKEEPKEDIDVSILPQLEHCSS
LKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVT
MILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNH
EEEKSRLLEKENRELERIVAEKEERVSELRLQLQSRQQLRSRRPPPTPPDPSGGLPRGPP
ELPDRLSCDGSRVHLLYK
NT seq 2937 nt   +upstreamnt  +downstreamnt
cctcggtcccccgcgggcccgcgggccacgccccagcccccgggccggggctgcaggctt
tgccttttccgtctcccaccttcctttctactccttggggctctcccctcaggttgccag
atcatacacccgccctgggaagggggcatccggtaccggggcctgactcgggaccaggtg
aaggccatcagcttcctgcccgtggactacgagattgagtatgtgtgccgcggggagcgc
gaggtggtggggcccaaggtccgcaagtgcctggccaacggctcctggacagacatggac
acacccagccgctgcgtccgaatctgctccaagtcctatttgatgctggaaaatgggaag
gtgttcctgacgggtggggacctcccagccctggatggagcccgagtggattttcggtgt
gaccctgacttccatctggtggggggctcccggagcatctgtagtcagggccagtggagc
agccctaagccccactgccagggtgaggggaacagcttgcctgagagcctgtccccccag
tgtgacccgggccaggccaccaagtacctgtacgagctgctctacaacgaccccatcaag
ataatcgtcatgcccggctgcagctccgtctccacgctggtcgctgaggctgccaggatg
tggaacctcattgtgctctcctacggctccagctcaccagccctgtcaaaccgacagcgc
ttccccaccttcttccgaactcacccgtcagccacgctgcacaatccaacccgggtgaaa
ctttttcaaaagtggggttggaagaagatcgccaccatccagcagaccaccgaagtcttc
acatcgactctggatgatctggaggaacgcgtgaaggaggctggcattgagattactttc
cgccagagtttcttctcagacccagctgtgcccgtgaagaacctgaagcgccaggatgcc
cgaatcatcgtgggacttttctatgagactgaagcccgaaaagtgttttgtgaggtgtac
aaggagcgactcttcggtaagaagtatgtctggttcctcatcgggtggtatgctgataac
tggttcaagacctatgacccgtccatcaactgcacagtggatgagatgaccgaagcagtg
gagggtcacatcaccactgagattgtcatgctgaaccccgccaacacccgcagcatttcc
aacatgacatcccaggagtttgtggaaaaactgaccaagcgactgaaacgacaccccgag
gagacaggtggtttccaggaggcgccgctggcttacgatgccatctgggccttggccctg
gccctaaacaagacgtccggagcgggtggccgttcaggagtgcgcctggaggacttcaac
tacaacaaccagaccatcactgaccagatctaccgggcaatgaactcctcatcctttgag
ggcgtctctggccatgtggtgtttgatgccagcggctctcggatggcgtggacactgatt
gagcagctccagggtggcagctacaagaagatcggctactatgacagcaccaaggatgat
ctttcctggtggaaaacagataagtggattggtgggtctccccctgctgaccagaccctg
gttatcaagacgttccgcttcctgtcacagaaactctttatctccgtctccgttctctcc
agcctgggcattgtcctagctgttgtctgtctgtcctttaacatctacaacgcccacgtc
cgttatatccagaactcacagcccaacctgaacaacctgacggcggtgggctgctcgctg
gcgctggcggccgtcttccccctcgggctagacggctaccacatcgggagacaccagttc
cccttcgtctgccaggtgaggggtgcgggcggcacccctgggaatgtgtctggcccaccc
gtcaggggcaccgtccgtgcccattggtccctgcctgcctccccagcggcggggctctgg
ccccggtcggcgccgtccctctttccgcacctgccggcttccatccccgggctggcggcg
agctcactgcagacgccggggctgcggggcttgcccggctcgccccgtgtctgcgtgggg
cgttcgcgcctccggggcgtggggtggcctgtttgcggggagaccaggggggcagctgtg
accctggagccctggaagctgtacgccacggtgggcctgctggtggccatggacgtgctc
accctcgccgtctggcagaccgtggaccccttgcacaggaccgtcgagactttcgcgaag
gaggagccgaaggaggacatcgacgtgtccatcctgccgcagctggagcactgcagctcc
ctgaagatgaacacgtggctgggcattttctatggttacaaggggctgctgctgttgctg
ggtatctttcttgcgtatgagaccaagagcgtgtccactgagaagatcaatgaccaccgg
gctgtgggcatggccatctacaatgtggcggtgctgtgcctcatcactgcgcccgtcacc
atgatcctgtccagccagcaggacgcggccttcgccttcgcctcgctcgccatcgtcttc
tcctcctacatcacgctggttgtgctgtttgtgcccaagatgcgccggctgatcacccgc
ggggaatggcagtcagaggctcaggacaccatgaagacagggtcctcgaccaacaaccat
gaggaggagaagtcccggctgctggagaaggagaaccgggagctggagagaatcgttgcc
gagaaagaggagcgagtctctgaactgcgccttcagctccagtctcggcagcagctccgc
tcacggcgcccccctcccacccccccagacccctctgggggcctacctaggggcccccct
gagctccctgaccgacttagttgtgatgggagtcgagtccatttgctttacaagtga

KEGG   Miniopterus natalensis: 107545035
Entry
107545035         CDS       T05883                                 

Gene name
GABBR2
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 2
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04727  GABAergic synapse
mna04742  Taste transduction
mna04915  Estrogen signaling pathway
mna04929  GnRH secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107545035 (GABBR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107545035 (GABBR2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107545035 (GABBR2)
   04915 Estrogen signaling pathway
    107545035 (GABBR2)
  09156 Nervous system
   04727 GABAergic synapse
    107545035 (GABBR2)
  09157 Sensory system
   04742 Taste transduction
    107545035 (GABBR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107545035 (GABBR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107545035 (GABBR2)
G protein-coupled receptors [BR:mna04030]
 Metabotropic glutamate receptor family
  GABA
   107545035 (GABBR2)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor GBR2_CC Peripla_BP_6 Cation_ATPase_C GAPT GWT1 DUF812 APG6_N HOOK
Other DBs
NCBI-GeneID: 107545035
NCBI-ProteinID: XP_016078549
LinkDB
Position
Unknown
AA seq 883 aa
MGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFY
DAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPS
DNAVNPAILKLLKYFHWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCT
SVKKLKGNDVRIILGQFDQHMAAKVFCCAYEENMYGSKYQWIIPGWYEPFWWEQVHKEAN
SSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYA
YDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFR
NGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKIS
LPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFG
LDGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLL
VIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLG
IVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPN
VQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVT
SVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDIL
NLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPI
LHHAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgggcctcatgcctctcaccaaggaggtggccaagggcagcatcgggcgcggcgtactt
cccgcggtggaattggccatcgagcagatccgaaatgagtcgctcctgcgcccctacttc
ctcgacctgcggctctacgacactgagtgtgataatgcgaaaggattgaaagccttctac
gatgcaataaaatatgggccaaaccacttgatggtgtttggaggcgtctgtccatctgtt
acatccatcatcgcagagtccctccaaggctggaatctggtgcagctttcctttgcggcg
accacacctgtcctagctgataagaaaaaatacccttatttcttccggactgtcccatca
gacaatgcggtgaatccagccatcctgaagctgctaaagtacttccattggaagcgagtg
ggcacactaacccaagatgtgcagaggttctctgaggtgaggaatgacctgaccggggtt
ctgtatggtgaggacattgagatttcagacaccgagagcttctccaatgatccctgcacc
agtgtcaagaagcttaagggcaatgacgtgaggatcatcctgggccagtttgaccagcat
atggcagcaaaagtgttctgttgtgcatatgaggagaacatgtatggtagcaaataccag
tggattatcccgggctggtatgagcctttctggtgggagcaagtgcataaagaagccaac
tcatcacgttgtctccggaagaatctgcttgctgccatggagggctatatcggcgtggac
tttgaacccctgagctctaagcagatcaaaaccatctcaggaaagacaccacagcagtat
gagagagagtacaacaacaagcggtcaggcgtggggcccagcaagttccacgggtacgct
tacgatggcatctgggtcatcgccaagacgctgcagagggccatggagacactgcacgcc
agcagccggcaccagcggatccaggacttcaactacacagaccacacgctgggcaggatc
atccttaacgccatgaatgagaccaatttcttcggggtcacgggtcaagttgtgttccgg
aacggggagagaatggggaccattaaatttactcaatttcaagacagcagggaggtgaag
gtgggagaatacaatgctgtggccgacacactggagatcatcaatgacaccattaggttc
caaggatccgaacctcccaaagacaagaccatcatcctggagcagctccggaagatctcc
ctacctctctacagcatcctctctgccctcactatcctggggatgatcatggccagcgct
tttctctttttcaacatcaagaaccggaatcagaagctgataaagatgtcgagtccatac
atgaacaacctcatcatcctgggaggaatgctctcctatgcatccatctttctctttggc
cttgacggatcctttgtctctgaaaagaccttcgaaacactttgcactgtcaggacctgg
attctcaccgtgggctacacaaccgccttcggggcaatgtttgcaaagacatggagggtc
cacgccatcttcaaaaatgtaaagatgaagaagaagataatcaaggaccagaaactgctt
gtgatcgtcgggggcatgctgctgattgacctgtgcatcctgatttgctggcaggctgtg
gaccccctgagaaggacggtggagagatacagcatggagccggacccagcaggacgggac
atctccatccgccccctcttggagcactgtgagaacacccacatgaccatctggctcggc
atcgtctatgcctacaaggggcttctcatgctgttcggttgtttcctagcttgggagacc
cgcaatgtcagcatccccgcgctcaacgacagcaagtacatcgggatgagcgtctacaac
gtggggatcatgtgcatcatcggggccgccgtctccttcctgacccgggaccagcccaac
gtgcagttctgcatcgtggcgctggtcatcatcttctgcagcaccatcaccctctgcctg
gtgttcgtgcccaagcttatcactctaagaacaaacccagatgcagcaactcagaacaga
cgtttccagttcactcagaatcagaagaaagaagattctaaaacatccacctctgtcacc
agcgtgaaccaagcaagcacatcccgcctggagggcctgcagtctgaaaaccaccgcctg
cgaatgaagatcacagagcttgataaagacttggaagaggtcaccatgcagctgcaggac
acaccagaaaagaccacctacattaaacagaaccattaccaagagctcaatgacatcctc
aacctggggaacttcactgagagcacagatgggggaaaggccattttaaaaaatcacctc
gatcaaaatccccagctgcagtggaacacaactgagccctcaagaacatgcaaagatcct
atagaagatataaactctccagaacacatccagcgccggctgtccctccagctccccatt
ctccaccacgcctacctcccgtccatcggaggcgtggatgccagctgcgtcagcccctgt
gtcagccccaccgccagcccccgccacagacatgtgccaccctccttccgagttatggtc
tcgggcctgtaa

DBGET integrated database retrieval system