KEGG   Miniopterus natalensis: 107544890
Entry
107544890         CDS       T05883                                 

Gene name
AQP7
Definition
(RefSeq) aquaporin-7 isoform X1
  KO
K08771  aquaporin-7
Organism
mna  Miniopterus natalensis
Pathway
mna03320  PPAR signaling pathway
mna04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107544890 (AQP7)
   03320 PPAR signaling pathway
    107544890 (AQP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107544890 (AQP7)
Transporters [BR:mna02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    107544890 (AQP7)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107544890
NCBI-ProteinID: XP_016078306
LinkDB
Position
Unknown
AA seq 299 aa
MGSGCCFRSSRKARITQSPTTVKMKAILRKEVVRVFLAELMSTYVMMVFGLGSVAHMILG
DKFGSYLAVNLGFGFGVTMGIHVAGKVSGAHMNAAVTFTNCALGYMPWKKFPVYILGQFL
GSFLAAGTIYCLFYTALMEYTGGHLTVTGSIATANIFATYLPAHMTLWRGFLDEMFVTGM
LQLCLFAITDKRNHPALEGTQSVLIGILVVILGVSLGMNSGYAINPSRDLPPRFFTFIAG
WGTQVFRYCPAQSTPSSFLWVPCMRRGGGDVRSNTGESCRAVRWPGEAGVGPDLPSHQH
NT seq 900 nt   +upstreamnt  +downstreamnt
atgggttcgggctgctgcttcaggtcttcccgcaaggccaggataacccagtcgcccacg
acagtgaagatgaaagcaatactgcggaaggaggtggtgcgagtgttcctggccgagctc
atgagcacatatgtcatgatggtgtttggccttggctctgtggcccatatgattctagga
gataaatttgggagctacctcgcggtcaacttgggttttggcttcggagtcaccatggga
attcacgtggcagggaaagtctctggggcccacatgaatgcagcggtgaccttcaccaac
tgtgcactaggctacatgccctggaagaagtttcctgtgtacatactgggtcagttcctg
ggctccttcctggctgctggcaccatctactgcctcttctacacagctcttatggagtac
acgggcggacatctgacagtgactggttctatagccaccgctaacatttttgccacctac
cttcctgcccacatgacattgtggaggggcttcctggatgagatgttcgttacggggatg
ctccagctgtgtctcttcgccatcacggacaagcgtaaccacccagcactggaagggaca
cagtccgtgttgattggcatccttgttgtcatccttggagtgtccctgggcatgaactca
ggatatgccatcaacccatcccgggacctgcctccccgcttcttcacctttattgctggc
tggggcacacaggtcttcaggtactgccctgcccagtccactccctcgagttttctgtgg
gttccttgcatgcggaggggtgggggtgatgtgaggagcaacacaggagagtcctgcaga
gctgtcaggtggcctggggaggcaggagtgggtcctgaccttccctctcaccagcactga

DBGET integrated database retrieval system