KEGG   Miniopterus natalensis: 107544891
Entry
107544891         CDS       T05883                                 

Gene name
AQP3
Definition
(RefSeq) aquaporin-3
  KO
K09876  aquaporin-3
Organism
mna  Miniopterus natalensis
Pathway
mna04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107544891 (AQP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107544891 (AQP3)
Transporters [BR:mna02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    107544891 (AQP3)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107544891
NCBI-ProteinID: XP_016078308
LinkDB
Position
Unknown
AA seq 292 aa
MGRQKELVARCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN
LAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPVYALAQTLGAFLGAGIVF
GLYYDAIWAFANNELIVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTASLIVCVLAIVD
PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGR
QWWWVPIVSPLLGSVAGVIVYQVMIGCHLEQPPPSTEQENVKLAHVKHKEQL
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggccgacagaaggagctggtggcccgctgcggggagatgctccacatccgctaccgg
ctgcttcgccaggcgctggccgagtgcctgggaaccctcatcctcgtgatgtttggctgt
ggctctgtggcccaggtcgtgctcagccggggcacccatggtggtttccttactatcaac
ctggcctttggctttgccgtcactctgggcatcctcattgctggccaggtctccggggcc
cacctgaaccctgctgtgacctttgccatgtgcttcctggcgagagagccctggatcaag
ctgcccgtctatgccctggctcagacactgggagccttcctgggtgctggaatcgttttt
gggttgtactatgatgcaatctgggccttcgccaacaatgaacttatagtctcaggcccc
aacggcacagctggcatctttgccacctatccttcgggacacttggacatggtcaatggc
ttcttcgaccagttcatcggcacagcctccctcatcgtgtgtgtgctggccattgtggac
ccctacaacaacccggtcccccgtggcctggaggccttcaccgtgggcctggtggttctg
gtcattggcacctccatgggcttcaactccggctacgctgtcaaccctgcccgggacttc
ggcccccgcctcttcaccgccctcgctggctggggctcagaagtgttcacgaccggccgc
caatggtggtgggtgcccatcgtctccccgctcctgggctccgttgcgggagtcatcgtg
taccaggtcatgattggctgccacttggagcagcctccaccctccactgagcaggagaac
gtgaagctggcccacgtgaagcacaaggagcagctctga

DBGET integrated database retrieval system