KEGG   Miniopterus natalensis: 107544926
Entry
107544926         CDS       T05883                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04929  GnRH secretion
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna05010  Alzheimer disease
mna05016  Huntington disease
mna05017  Spinocerebellar ataxia
mna05022  Pathways of neurodegeneration - multiple diseases
mna05135  Yersinia infection
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107544926 (GNAQ)
   04371 Apelin signaling pathway
    107544926 (GNAQ)
   04020 Calcium signaling pathway
    107544926 (GNAQ)
   04071 Sphingolipid signaling pathway
    107544926 (GNAQ)
   04022 cGMP-PKG signaling pathway
    107544926 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107544926 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107544926 (GNAQ)
   04062 Chemokine signaling pathway
    107544926 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    107544926 (GNAQ)
   04922 Glucagon signaling pathway
    107544926 (GNAQ)
   04929 GnRH secretion
    107544926 (GNAQ)
   04912 GnRH signaling pathway
    107544926 (GNAQ)
   04915 Estrogen signaling pathway
    107544926 (GNAQ)
   04921 Oxytocin signaling pathway
    107544926 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    107544926 (GNAQ)
   04918 Thyroid hormone synthesis
    107544926 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    107544926 (GNAQ)
   04916 Melanogenesis
    107544926 (GNAQ)
   04924 Renin secretion
    107544926 (GNAQ)
   04925 Aldosterone synthesis and secretion
    107544926 (GNAQ)
   04927 Cortisol synthesis and secretion
    107544926 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107544926 (GNAQ)
   04270 Vascular smooth muscle contraction
    107544926 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    107544926 (GNAQ)
   04971 Gastric acid secretion
    107544926 (GNAQ)
   04972 Pancreatic secretion
    107544926 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107544926 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    107544926 (GNAQ)
   04725 Cholinergic synapse
    107544926 (GNAQ)
   04728 Dopaminergic synapse
    107544926 (GNAQ)
   04726 Serotonergic synapse
    107544926 (GNAQ)
   04720 Long-term potentiation
    107544926 (GNAQ)
   04730 Long-term depression
    107544926 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    107544926 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107544926 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107544926 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544926 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107544926 (GNAQ)
   05016 Huntington disease
    107544926 (GNAQ)
   05017 Spinocerebellar ataxia
    107544926 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    107544926 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107544926 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107544926 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107544926 (GNAQ)
   05163 Human cytomegalovirus infection
    107544926 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107544926 (GNAQ)
   05142 Chagas disease
    107544926 (GNAQ)
   05143 African trypanosomiasis
    107544926 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107544926 (GNAQ)
   04031 GTP-binding proteins [BR:mna04031]
    107544926 (GNAQ)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107544926 (GNAQ)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    107544926 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 107544926
NCBI-ProteinID: XP_016078358
LinkDB
Position
Unknown
AA seq 301 aa
MRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDV
EKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQD
VLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQV
LVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGP
QRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL
V
NT seq 906 nt   +upstreamnt  +downstreamnt
atgagaatcatccacgggtccggatactccgatgaagacaaaaggggcttcaccaagctg
gtgtatcagaacatcttcacggccatgcaggctatgatcagagccatggacacgctcaag
atcccctacaagtacgagcacaataaggctcatgcacaattagttcgagaagttgatgtg
gagaaggtgtctgcttttgagaatccatacgtagatgcaataaagagtttatggaatgat
cctggaatccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaa
tactatcttaacgacttggaccgtgttgccgaccctgcctacctgcctacgcaacaagat
gtgcttagagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagt
gtcattttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacac
tgctttgaaaacgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagtt
ctcgtggaatcggacaacgagaaccgaatggaggaaagcaaagcactctttagaacaatt
atcacgtatccctggttccagaactcctcggttattctgttcttaaacaagaaagatctt
ctagaggagaaaattatgtattcccacctagtcgactacttcccggaatacgatggaccc
cagagagatgcgcaggcagcccgagaattcatcctgaagatgttcgtggacctgaacccg
gacagtgacaaaattatctactcccacttcacgtgcgccacagacaccgagaacatccgc
tttgtctttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctg
gtctaa

DBGET integrated database retrieval system