KEGG   Miniopterus natalensis: 107544941
Entry
107544941         CDS       T05883                                 

Gene name
NPR2
Definition
(RefSeq) atrial natriuretic peptide receptor 2 isoform X1
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04270  Vascular smooth muscle contraction
mna04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107544941 (NPR2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107544941 (NPR2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107544941 (NPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107544941 (NPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107544941 (NPR2)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107544941 (NPR2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107544941 (NPR2)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA
Other DBs
NCBI-GeneID: 107544941
NCBI-ProteinID: XP_016078381
LinkDB
Position
Unknown
AA seq 1044 aa
MALPSLLLLVAALAGGVRPPLARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWHLPLL
TAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTTRAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHHVYAREPGGPEQATHFIRSNGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGRPWQDNRTWEQAQALREAFQTVLVITYREPPNPEY
QEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVE
KMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGNFQPAAHYSGAEKQIWWTGRPIP
WVKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRPYRKLML
EKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHF
KGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCTRGS
LQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIAFHGSLKSSNCVVDSRFVLKITDY
GLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGP
FYLESLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDSAERPDFGQIK
CFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVA
EQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVY
KVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTG
PVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDV
EMKGKGKMRTYWLLGERKGPAGLL
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggcactgccatcactcctgctgttggtggcagccctggcaggtggggtgcgtcctccc
ttggcacggaacctgacgctggcagtggtgctgccagaacacaacctgagctatgcctgg
gcctggccacgggtgggtcctgctgtggcactagctgtggaagcgctgggcagggcactg
cccgtggacttgcggtttgtcagctctgaactagatggcgcctgctctgagtacctggca
ccactgcgcgcggtggacctcaagctgtaccatgaccctgacctgctgttgggccccggt
tgcgtgtaccccgctgcctctgtggcccgctttgcctctcactggcaccttcccttgctg
actgcgggtgctgtggcctctggttttgcggctaagaatgagcattatcgtaccctggtg
cgcactggcccctctgctcccaagctgggtgagtttgtagtgacattgcacgggcacttc
aattggactacccgtgctgccttgctgtacctggatgctcgcacagacgaccggccgcac
tacttcaccatcgagggcgtctttgaggccctgcagggcagcaacctcagtgtgcagcac
cacgtgtatgcccgtgagccagggggtcctgagcaggccacccacttcatccggtccaac
gggcgcattgtatatatctgcggccctctggagatgctgcatgagatcctgcttcaggcc
cagagggagaacctgaccaatggggattatgtcttcttttacctggatgtctttggggag
agtctccgtgcaggccggccctggcaggacaatcgcacctgggaacaggcccaggccctc
agagaggcctttcagacggtattggttatcacataccgagaacccccaaatcctgagtat
caagaattccagaatcgtctgctgataagagcccgggaagattttggtgtggagctggcc
ccctccctgatgaacctcatcgccggctgcttctatgatgggatcctgctatatgctgaa
gtcctgaatgagacaatccaggaaggaggcacccgggaagatggacttcgaattgtggaa
aaaatgcagggacgaagataccacggtgtaactggactggttgttatggacaagaacaat
gaccgggagactgattttgtcctgtgggccatgggagacctggattctggaaactttcag
cctgcagcccactactcaggagccgagaagcagatttggtggacgggacggcctatcccc
tgggtgaaaggggcaccccccttggacaatcccccctgtgcctttgacttggacgaccca
tcctgtgataaaactccgctttcaactctggccatcgtggcgctgggcacaggaatcacc
ttcatcatgtttggcgtgtccagcttcctcatcttccgtccttacagaaaactgatgctg
gagaaggagctggctagcatgttgtggcgcattcgctgggaagagctgcaatttggcaat
tcagagcgatatcacaaaggtgcaggcagtcgcctcacactgtcactgcggggatccagt
tacggctcgcttatgacagcccatgggaaataccagatctttgccaacaccggtcacttc
aagggaaatgtcgttgccatcaaacatgtgaataagaagcgcattgagctgacccggcag
gttctgtttgaactcaaacatatgagagatgttcagttcaaccatctcactcgcttcatt
ggtgcttgcatagaccctcccaacatttgcattgtcactgagtattgtactcgtgggagt
ttacaggatattctggaaaatgacagcatcaacttggactggatgtttcgctactcactc
attaatgaccttgttaagggcatggcctttctccataacagcattattgcattccatggg
agtctcaagtcctccaactgtgtggtggatagtcgttttgtgctcaaaatcacagactat
ggcctggccagcttccgatcaactgctgaacctgatgacagccatgctctctatgccaag
aagctatggactgccccagaactgctcagtgggaaccccttgccaaccacaggaatgcag
aaggctgatgtctatagctttgggatcatcttacaggagatagcacttcgcagtggtcct
ttctacttggagagcctggacctcagccccaaagagattgttcagaaggtcagaaatggt
cagcggccatatttccggcctagcattgaccggacccaactgaatgaggaactagttttg
ctgatggagcgatgttgggcccaggactcagctgagcggccagactttggacagattaag
tgcttcattcgccgttttaacaaggagggtggcacgagcatactggacaacctcctattg
cgcatggagcagtatgccaataacctggagaagctggtggaggaacgcacacaggcctat
ctggaggagaaacgcaaggctgaggctctgctctatcaaattctaccccattcagtggca
gagcagttaaagcggggagagactgtgcaggccgaggcctttgacagtgttaccatctac
ttcagtgacattgttggcttcacagctttatcagcagagagcacccccatgcaggtggtg
acacttcttaatgacctgtatacctgctttgatgccataattgacaactttgacgtctac
aaggtagagacgattggagatgcctacatggtggtatctggtctcccaggccgaaatggt
caacgccatgccccggaaattgctcgtatggccctagcattactggatgcagtttcttcc
ttccgaattcgccaccgaccccatgaccaactgaggctacgcataggggtccacacgggc
ccagtctgtgctggggttgttggcctgaagatgccccgctattgccttttcggagacacg
gtgaacactgcttcccgaatggagtctaatggtcaagccctgaagatccatgtctcctct
accaccaaggatgccctggatgagctaggatgcttccagctagagcttcggggggatgtg
gagatgaagggaaaaggaaagatgcgaacttactggctcctaggagagcggaaaggacct
gctggactcctgtaa

DBGET integrated database retrieval system