KEGG   Miniopterus natalensis: 107545083
Entry
107545083         CDS       T05883                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna04014  Ras signaling pathway
mna04390  Hippo signaling pathway
mna04392  Hippo signaling pathway - multiple species
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05219  Bladder cancer
mna05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107545083
   04390 Hippo signaling pathway
    107545083
   04392 Hippo signaling pathway - multiple species
    107545083
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545083
   05206 MicroRNAs in cancer
    107545083
  09162 Cancer: specific types
   05219 Bladder cancer
    107545083
   05223 Non-small cell lung cancer
    107545083
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 107545083
NCBI-ProteinID: XP_016078610
LinkDB
Position
Unknown
AA seq 244 aa
MGFPTVPNKLDGFLKGPCWSIFQDEPVEWETSDLSQAEIEQKIKEYNGQINSNLFMSLNK
DGSYTGFIKVQLKLVRPVSVPSSKKPPTLQDARRGPGRSAAVRRRTSFYLPKDTVKHLHV
LSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSE
KALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHA
CPLG
NT seq 735 nt   +upstreamnt  +downstreamnt
atggggtttcccactgtccccaacaagttggatgggttccttaagggtccatgttggtcc
atctttcaggatgagcctgtggagtgggagacatcagacctttctcaggctgagattgaa
cagaagatcaaggagtacaatggccagatcaacagcaacctcttcatgagcctgaacaag
gatggctcctacacaggcttcatcaaggttcaactgaagttggtgcgccccgtctcagtg
ccctccagcaagaagccacccaccttgcaggatgcccggcgaggcccagggcggagcgct
gcagtgaggcgccgcacctccttctacctacccaaggatactgtcaagcacctgcatgtg
ttgtcacgcacgcgggcacgagaggtcattgaggccctgctgcgcaagttcttggtggtg
gatgacccccgcaagtttgcgctctttgagcgggctgagcgccatggccaagtgtacctc
cggaagctgtcagatgatgagcagcccctgcggctgcggctccttgccgggcccagtgag
aaagccctaagctttgtcctgaaagagaatgattctggggaggtgaactgggatgccttc
agcatgcctgaactccacaacttcctgcgcatcctacagcgggaggaagaggaacacctc
cgccagatcctgcagaagtactcctactgccgccagaagatccaggaggccctgcatgcc
tgccccctggggtga

DBGET integrated database retrieval system