KEGG   Miniopterus natalensis: 107545102
Entry
107545102         CDS       T05883                                 

Gene name
ANO4
Definition
(RefSeq) anoctamin-4
  KO
K19499  anoctamin-4
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107545102 (ANO4)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107545102 (ANO4)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 107545102
NCBI-ProteinID: XP_016078629
LinkDB
Position
Unknown
AA seq 1147 aa
MYRLPFDLQPFTFEKFLSGGQELQPEDKRGVAVTSRTTGLAQSSGRYRDAAAAANKDVSS
GSYNLSTATTGSYYSCVSQITIGYDVSGPVAIGVTHWKNPYAQGRPALPSDLPLFVSKDA
GIPVCHQSLTRKTELATPLSCPASLSITPVPSYSSSSQETLSQDTTGLSLSIHGAEKRLQ
VHQRRSVASRPGSRRLPVVRHSSLPPSRRSIRMEASSSGITNGKTKAFHAEGGYQLDMQI
LPDGPKSDVDFSEILNAIQEMAKDVNILFDELEAVNSPCKDDDSLLHPGNLTSTSDDASR
LEAGGEAARGKHRSNGLRFRDGKCRIDYVLVYRKSNPQTEKREVFERNIRAEGLQMEKES
SLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRIDKQISRFRRWLPRKPMRLDKETLPDL
EENDCYTAPFSQQRIHHFIIHNKDTFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTN
GSYEAAFPLHEGGYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIG
LYFAWLGWYTGMLFPAAFIGLFVFLYGVITLDHCQVSKEVCQATDIIMCPVCDKYCPFMR
LSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEI
RPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRV
VTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALFLTNLEQPRTESEW
ENSFTLKMFLFQFVNLNSSTFYIAFFLGRFAGHPGAYLRLINRWRLEECHPSGCLIDLCM
QMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKLSFPQWEKDYNLQPMNAYG
LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNVIEIRLDAYKFVTQWRRPLASRAKDIG
IWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLS
VFRIADFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFI
IVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKERKKNGK
AHHNEWP
NT seq 3444 nt   +upstreamnt  +downstreamnt
atgtacagactgccctttgaccttcagcccttcacatttgagaagtttctttctgggggc
caggaactgcagccggaagataagcggggggtggccgtgacctccaggactacgggtcta
gctcagtccagtggaagatacagggatgctgctgctgccgctaacaaagatgtgagcagt
gggagttataacctctccaccgcaacgacgggcagctactacagctgtgtcagccagatc
accataggttatgacgtttccgggcctgttgcaattggggtcacccactggaaaaatccg
tatgctcaaggcagacctgccctcccatcagacctgcctctcttcgtctccaaagatgca
ggcatccccgtgtgtcaccagtcccttacccgcaagacggagctggccacgcctctgtcc
tgcccagcttcactgtccatcactccagtgccttcctacagcagcagcagccaggaaacc
ctgagtcaagacacgacaggtttaagtttatctattcatggggctgaaaagcgtttgcaa
gtccatcaacggcgaagtgtggcaagccgcccagggtcacgccgcctgcccgtggtcagg
cattcctcactcccaccgagtagaaggtcaataagaatggaggcaagctcttctggaatc
accaatggcaagaccaaggccttccacgcagaaggaggctaccagctggatatgcaaata
ctacccgacggcccaaagagtgatgtggacttttcagagattcttaatgcaattcaagaa
atggccaaggatgtcaatattcttttcgatgagttagaagctgtcaacagtccttgcaaa
gatgacgattctctccttcaccctggaaacctgaccagtacttcagatgatgccagcaga
ttggaagcagggggagaggcggcgcggggcaagcacagatccaacggcctgcgcttcagg
gacggcaagtgccgcatcgactacgtccttgtgtacagaaaatccaacccccagacggaa
aagagggaagtgtttgagagaaacatcagagcagaaggattgcaaatggagaaagagtcc
tctctaataaacagtgacattatctttgtgaagttgcatgccccatgggaagtgcttgga
agatacgcagaacaaatgaatgtaagaatgcctttcaggatcgataaacaaataagcagg
tttcggagatggttacctaggaagccaatgagattggacaaggagacactgccagacctg
gaggagaatgactgctacactgcccccttcagccagcaaaggatccatcacttcatcata
cacaacaaagacacgttcttcaacaacgccacgagaagtagaatcgtacatcatatttta
cagagaataaagtacgaagaagggaaaaacaaaattggtctgaatcgtttgcttaccaat
ggctcctatgaagctgctttccctctgcacgagggaggttacaggagtaaaaactccatt
agaacccatggagcggaaaaccaccgacacctgctctatgagtgctgggcctcctggggc
gtgtggtacaaataccagcctttggatctcgtaaggcggtattttggagagaagattggc
ctgtattttgcctggttggggtggtacaccggcatgctcttcccagctgccttcattgga
ctgtttgtctttttgtatggagtcatcactctggatcactgccaagtcagtaaagaagtc
tgccaagctacagatatcatcatgtgtcctgtgtgtgataaatactgtccattcatgagg
ctgtcagacagctgcgtttatgccaaggtcacccacctttttgacaacggagccactgtc
ttctttgctgtgttcatggcagtctgggcgacagttttcctggagttttggaaaagacgg
cgagcagtgattgcttatgactgggatttgatagactgggaagaggaggaggaagaaata
cggccccaatttgaagccaagtattccaagaaagagcggatgaaccccatttcgggaaag
ccagaaccatatcaagcatttacagataaatgcagccgactgatcgtctctgcatcagga
atattttttatgatctgcgtggtgatcgccgccgtgtttgggatcgtcatttaccgggtg
gtgaccgtcagcactttcgcggccttcaagtgggcgttgatcaggaataactcgcaggtt
gcaaccacagggactgccgtgtgcatcaacttctgtatcatcatgctgctgaacgtgctc
tatgaaaaagttgcgctttttctgactaacttagaacagcctcgcacggagtccgagtgg
gagaacagcttcaccctgaaaatgtttctttttcagtttgtcaatctgaacagctccacg
ttttacattgcgttcttcctcggaagatttgcaggacaccccggtgcctacttgaggctg
ataaacaggtggagactggaagagtgccaccctagtggatgccttattgatctctgtatg
caaatgggtattataatggtgctaaagcagacctggaataatttcatggaacttggctac
ccgttgattcagaactggtggacccggaggaaggtgcggcaagagcacgggcccgagagg
aagctgagcttcccgcagtgggagaaggattacaacctgcagcccatgaacgcctacgga
ctcttcgatgagtacctagaaatgattcttcagtttggattcacaactatctttgtggca
gcctttcctctagcaccacttctggccttactgaataacgtaatcgaaattcgacttgat
gcttacaaatttgtcacacaatggaggcgacctttagcttcaagggccaaagacatagga
atttggtatggaattcttgaaggcatcggcattctctccgttattaccaacgcgtttgtc
atagcgataacgtcggacttcatccctcgcctggtgtacgcttataagtacggaccttgt
gcgggccaaggagaagctgggcaaaagtgcatggttggctatgtgaatgccagtttgtct
gtgtttcgaattgctgactttgagaaccgatcggagcctgagtctgatggcagcgagttc
tcagggactcctctcaagtactgcagataccgagactaccgtgacccccctcattcactg
gtgccctacggctacacgctgcagttctggcatgtcctagcagctcgcctggctttcatc
attgtgtttgagcacctcgtgttttgtataaagcacctcatttcatatctgatcccagac
ctcccaaaagatctaagggatcgaatgagaagggagaagtacttgattcaggagatgatg
tatgaagcagaactggagcgtctccagaaggaacggaaggagagaaagaaaaacggcaaa
gcacatcacaacgagtggccatga

DBGET integrated database retrieval system