KEGG   Miniopterus natalensis: 107545129
Entry
107545129         CDS       T05883                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04115  p53 signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05134  Legionellosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05164  Influenza A
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107545129 (APAF1)
   04215 Apoptosis - multiple species
    107545129 (APAF1)
   04115 p53 signaling pathway
    107545129 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545129 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107545129 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107545129 (APAF1)
   05012 Parkinson disease
    107545129 (APAF1)
   05014 Amyotrophic lateral sclerosis
    107545129 (APAF1)
   05016 Huntington disease
    107545129 (APAF1)
   05020 Prion disease
    107545129 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    107545129 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107545129 (APAF1)
   05152 Tuberculosis
    107545129 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107545129 (APAF1)
   05160 Hepatitis C
    107545129 (APAF1)
   05164 Influenza A
    107545129 (APAF1)
   05162 Measles
    107545129 (APAF1)
   05168 Herpes simplex virus 1 infection
    107545129 (APAF1)
   05169 Epstein-Barr virus infection
    107545129 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107545129 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 WD40_like CARD_2 AAA_16 NACHT ATPase_2 AAA_22
Other DBs
NCBI-GeneID: 107545129
NCBI-ProteinID: XP_016078668
LinkDB
Position
Unknown
AA seq 1253 aa
MDAKARNCLLQHREALEKDIKTSYIMDHMISDRVLTPLEEEKVKNEPTQQHRAAMLIKII
LKKDNYSYISFYNALLHEGYKDLAVLLHGGLPDVSSSNDKDSAGGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLNGEPGWVTVYGMAGCGKTVLAAEAVRDHVFLESCFPG
GVHWVSVGKQDKSGLLMKLQNLCMRLDQDESSSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDIWDPWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEEAHSIIKECKGSPLVVSLIGALLRDFPERWGYYLRQLQNKQFRRIRKSSSYD
YEALDEAMSISVEMLREDIKGYYTDLSVLQKDVKVPTKVLCVLWDMETEEVEDILQEFVN
KSLLFCDRNGKSFCYYLHDLQVDFLTEKNRSQLQDLHKKVITQFQRHHQLHTLSPDQEDC
MYWSNFLAYHMASADMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRDILDEKDYAV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLKAKQEADNGMLYLEWTNK
KNIKNLSRLVVRPHTDAVYHACFSEDGHRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDKFIATCSADKKVKIWNSVTGQLVHSYEEHSEQVNCCHFTHNRHHLLLATGS
SDCVLKLWDLDQKRCRNTMFGHTSSVNHCRFSPDDKLLASCSADGTLKLWDVVKSANERS
SINVKQFFLSSEEPQEEMEVIVKCCSWYSDGSKIMVAAKNKIFLFDFRTSGVLAEIHTGH
HSTIRYCDFSPHNHLAVVALSQYCVEILKLWNVDSGLKVADCRGHLSWVHCVMFSPDGSS
FLTSSDDQTIRLWETKKVCENSAIVLKQEIDVVFQENEVTVLAVDNIRRLQLINGKTGQI
DYLTEAQVSCCCLSPHLQHVAFGGHDGTIQILELLNNRIFQSRNGHKNTVWHIQFTADGK
TLISSSDDSTIQVWNWQSEEYFFLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWNITTGR
IEKDFVCHQDTVLSCDISPDATKFSSTSADNTAKIWSFEHLSPLHELKGHKGCVRCSAFS
VDSTLLATGDDNGEIRIWSVSDGALLHLCAPVSIEEGAATHGGWVTDLCFSPDSKTLVSA
GGYLKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQILE
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagccctggaaaaagacatc
aaaacatcctacataatggatcacatgattagtgatagagttttaacacctttggaagaa
gaaaaagtgaaaaatgagcccactcaacagcatcgagcagctatgctaataaaaattata
cttaagaaagataattattcctacatatcattctataatgctttactacatgaaggttat
aaagatcttgctgtccttctccatggtggccttcccgatgtctcttcttccaatgacaaa
gattcagctggtggaataacttcgtatgtaagaacagtcctgtgtgaaggaggagtacca
cagaggccagttgtttttgttactaggaagaagctggtgaatgcaattcagcagaagctc
tccaaactgaatggtgaaccgggatgggtcactgtatatggaatggcaggctgtgggaag
actgtattagctgcagaagctgttcgagatcatgtcttcttagaaagttgcttccccggg
ggtgtgcattgggtttcagttgggaaacaagacaaatccgggcttctgatgaaactgcag
aatctttgtatgcggttggaccaggatgagagcagctcccagaggcttccacttaatatt
gaagaggctaaagaccgtctccgcattctgatgctgcgcaaacacccaaggtctctgctg
atcttggatgatatttgggatccctgggtgttaaaagcttttgacagtcagtgccagatt
cttcttacaaccagagacaagagtgttacagattcagtgatgggtcctaagtatgtcgtc
cccgtggagagtagcttaggaaaagagaaaggacttgaaatcttatccctttttgttaac
atgaagaaagcggatttgccagaagaagctcatagtattataaaagagtgtaaaggttct
cctcttgtagtgtctttgattggtgctcttttacgtgattttcctgaacgctgggggtac
tacctcaggcaacttcagaataagcagtttaggaggataaggaagtcttcatcttatgat
tatgaggctctggatgaagccatgtccataagtgttgaaatgctccgagaagacatcaaa
ggttattacacagatctttccgtcttgcagaaggatgttaaggtgcctacaaaggtgtta
tgtgttctctgggacatggaaaccgaagaagttgaagacatactgcaggagtttgttaat
aagtctctgttattctgtgatcgaaatggaaaatcattttgttattatttgcatgatctt
caagtagatttccttacagagaagaaccgcagccagcttcaggatctgcataagaaggta
atcactcagttccagagacatcaccaactacatactctttcaccagatcaggaggactgc
atgtactggtccaattttctggcctatcacatggccagtgccgatatgcacaaagaactt
tgtgctttaatgttttccctggattggattaaagcaaaaacggaactcgtcggccctgct
catctgattcatgaatttgtggaatacagggatatactggatgaaaaggattatgcagtc
tgtgagaatttccaggagtttttatctttaaatggacatcttctcggacgacagccattt
cctaatattgtacaactgggtctctgtgaaccggaaacttcagaagtttatcagcaagca
aagctgaaggccaagcaggaggctgacaacgggatgctttacctagagtggacaaacaaa
aaaaacatcaagaatctctcccgcttagttgtccgcccccatacagatgctgtttaccat
gcttgcttttctgaggatggtcacagaatagcttcttgtggagctgataaaaccttacag
gtgttcaaagctgaaacaggagagaaacttctagaaatcaaagctcatgaggatgaagtg
ctttgctgtgcattctctacagatgacaaatttatagcaacctgctcagcggataaaaaa
gtgaagatttggaattctgtgactgggcaactggtgcacagctatgaagagcactcagag
caggtcaactgctgccacttcactcacaacagacatcaccttctcttagctactgggtca
agtgactgcgtcctcaaactctgggatttggatcaaaaacggtgtcgaaataccatgttt
ggccataccagttcagtcaatcactgcagattttcaccagacgataagcttttggccagt
tgttcagctgatggaactttaaagctttgggatgttgtgaaatcagccaatgagaggagc
agcattaatgtgaagcagttcttcctaagttcagaggagcctcaggaggagatggaagtg
atagtgaagtgttgttcctggtattctgatggctctaagataatggtggcagcaaaaaat
aaaatctttctttttgactttcgtaccagtggtgtgttggcagaaatccacacaggccat
cacagcaccatccggtactgtgacttctccccccataaccatttggcagtggtggctttg
tcccagtactgtgtggagatcctcaagctgtggaacgtggactcaggtttaaaagtggct
gattgcagaggacatttaagttgggttcattgtgtgatgttttctcctgatggatcatca
tttttgacatcttctgatgaccagacgatcaggctctgggagacaaagaaagtatgtgag
aactctgctatagtgttaaagcaagaaatagatgttgtgtttcaagaaaatgaagtgacg
gttctggcagttgacaatatacgacgtctgcaactcattaatggaaaaacaggtcagatt
gattatctgactgaagctcaggttagttgctgctgcttaagtccgcatctgcagcacgtt
gcatttggaggccacgacggaaccattcagattttagaactcctaaacaacagaatcttc
caatccaggaatgggcacaagaacactgtatggcacatccagttcacagctgatgggaag
acactcatttcaagctctgatgattctacaattcaggtatggaattggcaatcagaggag
tatttcttcctgcaagcccatcaggaaacagtgaaagacttcaggctcttgaaaaattca
agactgctttcctggtcatttgatggaacggtgaaggtgtggaatatcactactggaaga
atagaaaaagacttcgtctgtcaccaggatactgtactttcttgtgatatttctcctgat
gctaccaagttttcatctacctctgctgacaacactgcaaagatttggagttttgaacac
ctttcccctcttcatgaattgaagggccacaaaggctgtgtgcgctgctctgccttctct
gtggacagcaccctgctggcaactggagatgacaatggagaaatcaggatatggagtgtc
tcagacggtgcgcttcttcatttgtgtgctcctgtttccatagaagaaggagctgctacc
cacggaggctgggtgaccgacctctgcttctctccagatagcaagacgctggtctctgct
ggaggctatctgaagtggtggaatgttgtcactggggaatcctcacagaccttctacaca
aatggaaccaatcttaagaaaatacacgtgtcccctgacttcaagacatatgtgactgtt
gataatcttggtattttatatattttacagattttagaataa

DBGET integrated database retrieval system