KEGG   Miniopterus natalensis: 107545155
Entry
107545155         CDS       T05883                                 

Gene name
HSP90B1
Definition
(RefSeq) endoplasmin
  KO
K09487  heat shock protein 90kDa beta
Organism
mna  Miniopterus natalensis
Pathway
mna04141  Protein processing in endoplasmic reticulum
mna04151  PI3K-Akt signaling pathway
mna04657  IL-17 signaling pathway
mna04915  Estrogen signaling pathway
mna04918  Thyroid hormone synthesis
mna05132  Salmonella infection
mna05200  Pathways in cancer
mna05215  Prostate cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545155 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107545155 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107545155 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107545155 (HSP90B1)
   04918 Thyroid hormone synthesis
    107545155 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545155 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107545155 (HSP90B1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107545155 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107545155 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107545155 (HSP90B1)
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP90
   107545155 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518 MH1
Other DBs
NCBI-GeneID: 107545155
NCBI-ProteinID: XP_016078712
LinkDB
Position
Unknown
AA seq 800 aa
MRALWVLGLCCLLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEAAKE
EKEESDDEAAVEEEDEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKS
FSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD
FHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYN
DTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSSDITSLDQYVERMKEKQDKIYFM
AGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDES
EKTKENREAIEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERI
MKAQAYQTGKDISTNYYASQKKTFEINPRHPLIKDMLRRVKEDEDDKTVSDLAVVLFETA
TLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETTEDTAEDTEQDEDED
MDAGTDEEETEKSTVEKDEL
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcctactgctgaccttcgggtcagtccga
gctgatgatgaagtcgatgtggatggcacggtagaagaggacctgggtaaaagtagagaa
ggctcaaggacagatgatgaagtagtacagagagaagaagaagctattcagttggatgga
ttaaatgcatcccaaataagagaacttcgagagaaatcagaaaagtttgcctttcaagca
gaagtaaacagaatgatgaaacttatcatcaattcattgtataaaaataaggagattttc
ctgagagaactgatttcaaatgcttctgacgctttagataagataaggctgatatcactg
actgatgaaaatgctctttctggaaatgaggaactaacagtcaaaattaagtgtgacaag
gagaagaacctgctacatgtcacagacactggtgtaggaatgaccagggaagagttggtt
aaaaaccttggtaccattgccaaatctgggacaagcgagtttttaaacaaaatgactgaa
gcacaagaagatggccagtcaacttctgaattgattggccagtttggtgttggtttctat
tctgccttccttgtagcagataaggttattgtcacatcaaaacacaacaacgatacccag
cacatctgggaatctgactccaatgaattttctgtaattgctgatccaagaggaaacact
ctaggacgaggaacgacaattacccttgttttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaagtactcacagttcataaactttccaatttat
gtatggagcagcaagactgaaactgttgaggaacccatggaagaagaagccgcaaaagaa
gaaaaggaagaatctgatgatgaggctgcagtagaagaagaagacgaagaaaagaaacca
aaaactaaaaaagttgagaagacggtgtgggactgggaacttatgaatgatatcaaaccg
atatggcagagaccatcgaaagaagtagaggaggatgagtataaagctttctacaagtcg
ttttccaaggaaagcgatgaccccatggcttatatccactttactgctgaaggggaagtt
acctttaagtcaattttatttgtacctacatctgctccacgtggtctgtttgatgaatat
ggatctaagaagagcgattacattaagctctatgtacgccgagtgttcatcacagatgac
ttccatgatatgatgcccaaataccttaattttgtcaagggtgttgtggactcagatgat
ctccccttgaatgtttcccgtgagactcttcagcaacataaactacttaaggtgattaga
aagaagcttgttcgtaaaactctggacatgatcaaaaagattgctgatgagaaatacaat
gatactttctggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccactca
aatcgaacacgtcttgctaaactcctcaggttccagtcttctcatcattcaagtgacatt
actagtctagaccagtatgtggaaagaatgaaggagaaacaagacaaaatctacttcatg
gctgggtccagcagaaaagaggccgaatcttctccatttgttgagcgacttctgaaaaag
gggtatgaagttatttatctcacagaacctgtggatgaatactgcatccaggctcttcct
gagtttgatgggaagaggttccagaacgttgccaaggaaggagtgaagtttgatgaaagt
gagaaaactaaggagaatcgtgaagcaattgagaaagaatttgagcctctgctcaactgg
atgaaagataaagccctcaaggacaagattgaaaaggctgtggtatctcagcgcctgaca
gagtctccgtgtgcccttgtggccagccagtacggatggtctggcaacatggagagaatc
atgaaagctcaagcctaccaaacaggcaaggacatctctacaaattactatgccagccag
aagaaaacatttgaaatcaatcccagacatccgctgatcaaagacatgcttcgacgagtc
aaggaagacgaagatgacaaaacagtttcggatcttgccgtggttttgtttgaaacagca
acactgaggtcaggatatcttttaccagacactaaagcatatggagatagaatagaaaga
atgcttcgcctcagtttaaacattgaccctgatgcaaaggttgaagaagaacctgaagaa
gaacctgaagaaacaacagaggacactgcagaagacacagagcaagacgaagacgaagac
atggacgccggaacagacgaagaagaaacagagaagtctacagttgaaaaagatgaattg
taa

DBGET integrated database retrieval system