KEGG   Miniopterus natalensis: 107545288
Entry
107545288         CDS       T05883                                 

Gene name
HSD3B2
Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Module
mna_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
mna_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107545288 (HSD3B2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107545288 (HSD3B2)
   04925 Aldosterone synthesis and secretion
    107545288 (HSD3B2)
   04927 Cortisol synthesis and secretion
    107545288 (HSD3B2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107545288 (HSD3B2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     107545288 (HSD3B2)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     107545288 (HSD3B2)
SSDB
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind KR NmrA
Other DBs
NCBI-GeneID: 107545288
NCBI-ProteinID: XP_016078815
LinkDB
Position
Unknown
AA seq 373 aa
MAGWSCLVTGAGGFLGQRIVRLLVEETELQEIRVLDKVFRPELREEFSKLQSKIKLTLLE
GDILDEQFMKRACQGTSTVIHTAAVIDVFNVLPPETIMNVNLKGTQILLEACAQASVPIF
IYTSTIEVAAPNSYRETIQNACEEEHLETSWSAVYPRSKKLAEKAVLAANGWALKNGGTL
YTCALRPTYIYGEGNPFLHGFIDHALRNNGILPRNSKFSIVNPVYVGNAAWAHILALRAL
RDPEKAPNIQGQFYYISDDTPHQSYDELNYTLSKEWGFSLDSGMSLPVSLKYWLGFLLEM
VSFLLSPVYRYQPPFDRHAVTLLNSVYTFSYKKAQQELGYEPLFSWEKAKQNTTEWVGSL
VEQHKKALKTETH
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggccgggtggagctgccttgtgacaggtgctggaggcttcctggggcagaggatcgtc
cgcctgttggtggaggagaccgagctgcaggagatccgggtgctggacaaagtcttcaga
cccgagttgcgggaggagttttctaagctccagagcaagatcaagctgaccctgctggaa
ggagatattctggacgaacaattcatgaagagagcttgccagggcacttcgactgtcatt
cacaccgccgccgtcattgacgtcttcaatgtgctcccgcctgagaccatcatgaatgtc
aacctgaaaggtacccaaatcctgctggaggcctgtgcccaggccagtgtgcccatcttc
atttacaccagcaccatagaggtggctgcacccaactcctacagggagaccatccagaat
gcctgcgaagaggagcatctcgagacctcgtggtcggctgtgtacccacggagcaaaaag
cttgccgagaaggccgtgctggcagcgaatgggtgggcccttaaaaatggtggcaccttg
tacacttgcgccttaaggcccacgtacatctatggggaaggaaacccattccttcatggc
tttattgaccacgccctgagaaacaatggcatcctgccacggaacagcaagttctccatt
gtcaacccagtctatgttggcaacgcggcctgggcccacatcctggccctgagggccctg
cgggaccctgagaaagcccccaacatccaaggacagttctactacatctcagatgacaca
cctcaccaaagttacgacgagctcaactacactttgagcaaagaatggggcttctccctt
gactccggaatgagcctgcctgtatccctgaagtactggcttggcttcctgctggaaatg
gtgagcttcctgctcagtcccgtctacaggtatcaaccccccttcgaccgccacgcagtg
acactgctaaatagtgtgtacactttctcctataagaaagctcagcaagagctgggctat
gagcctctcttcagctgggagaaggccaagcagaacaccacggagtgggttggctccctg
gtggagcagcacaagaaagccctgaaaacagagactcactga

DBGET integrated database retrieval system