KEGG   Miniopterus natalensis: 107545304
Entry
107545304         CDS       T05883                                 

Gene name
TTF2
Definition
(RefSeq) transcription termination factor 2
  KO
K15173  transcription termination factor 2 [EC:3.6.4.-]
Organism
mna  Miniopterus natalensis
Pathway
mna04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107545304 (TTF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107545304 (TTF2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     107545304 (TTF2)
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     107545304 (TTF2)
SSDB
Motif
Pfam: SNF2_N Helicase_C ResIII zf-GRF DEAD
Other DBs
NCBI-GeneID: 107545304
NCBI-ProteinID: XP_016078847
LinkDB
Position
Unknown
AA seq 1164 aa
MELVRCPEHGTICFLKTGVREGPNKGKSFYVCGADACTFVRPTDVPVSHCLLHEGVVVEL
QGLLPQQSTKEYRLVFRCIGSKAEKKQWCGCIPWRDPNSKEHSVTSKSRHVSEPSHYPAI
QQRNPFKVLDKNQEPSLWKQVIKGEGEEKMVGKKQSEKGDPPLIQKKEQKPESNCQTEED
VSHGLMVKKKAVGQGKPLGEKTELHCEAKKVEGTHKRDLSEIKSKPCHGDELRKPSASHQ
EKPIGESHHVQKESEPVREKETKPLPQVAPSQKPMNKSPGAGHLSKEQPKSWEARETKAK
DAPSTQATQKRLQGHCQAQAEARPVPAPKAPAPQSAPQAAGPSLGARQESDTSSSDSEED
VIFVSSQPGYPSLSDRTSDSRKKENLQFPGHTGQRKMSPASGAPKKVEPSDPAAQRAYLT
TQLKQKKSTLASVNIQVLPDKGQKLLKQIQELEEALGALALSPEQGADEKNNTEVPQQSN
FTETTTTPPHLVPPKPLQGQAHQHLGSLGLKAACQVAAGQSSQCFRGPANQDRLQAVWKI
TSEAIDALHRSLESCPGEAAVAEDPAGLKVPLLLHQKQALAWLLWRESQKPQGGILADDM
GLGKTLTMIALILTQKDRVENREKDNSAPLTWLSKDDPTEFTSHGTLVVCPASLIHHWKK
EVEKRVSRSRLRVCLYHGPDRDQRARVLSTYDIVITTYSILAREIPTEKQEGLAPSTNLS
EEEISTPLLRIVWARIILDEAHNIKNPRVQTSIAVCKLQAHARWAVTGTPIQNNLLDMYS
LLKFLRCSPFDQFSLWKSQVDNDTKKGGERLSILTKSLLLRRTKDQLDSTGKPLVVLPQR
KFQLHHLKLSEDEEMVYSVLFARSRSALQSYLKRQEGGDSQSGRSPDNPFSRVAQEFGSS
GPGRSVAADSQKSSTAHILSQLLRLRQCCCHLSLLKSALDPTELKSEGLLLSLEDQLNAL
TLSELQNSEPASTVSLNGECFPAELFEDTRESTKISSLLAELEAIQRNSGSQKSVIVSQW
TSMLKVVALHLRRHRLTYATIDGSVSPKQRMDLVEAFNNSRGPQVMLISLLAGGVGLNLT
GGNHLFLLDMHWNPSLEDQACDRIYRVGQQNDVVIHRFVCEETVEEKILQLQEKKKDLAR
QILSGSGESVTKLTLADLKVLFGI
NT seq 3495 nt   +upstreamnt  +downstreamnt
atggaattggttaggtgtccggagcacgggaccatctgctttctgaagaccggcgtccgc
gagggtccgaataaaggaaagagcttctatgtgtgcggggcggacgcgtgcaccttcgtg
cggcccaccgatgttcctgtctctcattgtttattgcatgagggtgttgtggtggagctt
cagggcttacttccacaacagagcacaaaagaatatagattggtcttccgatgcattgga
agtaaggccgagaagaagcaatggtgtggatgtataccatggcgggatcctaattccaaa
gagcactctgtaaccagcaagtctcggcatgtgtctgagccatctcattaccctgccatt
cagcagagaaacccgttcaaggtccttgacaagaatcaagaaccatctctgtggaaacag
gtcatcaaaggtgaaggcgaggaaaagatggtgggtaagaagcaaagtgaaaagggagac
ccgcccttaattcaaaagaaggaacagaagcctgaatctaactgccagacagaggaagat
gtctcacatggcctgatggtaaagaaaaaagctgtaggtcaagggaaaccactaggggag
aagacagagcttcactgtgaggcaaagaaggttgaagggacgcacaaaagagacctgtct
gagattaaatccaaaccgtgccatggtgatgagctgagaaaaccatctgcatctcatcag
gagaaaccgattggtgagagtcatcatgttcaaaaagaatcagaacctgtgagagaaaag
gaaaccaagcctttgcctcaagttgctcccagccagaagccaatgaacaagtccccagga
gcaggacacctcagcaaggagcagcccaagagctgggaggccagagaaacaaaggcgaag
gatgccccgagcacgcaggccacccagaagaggctccaggggcattgccaggcgcaggcg
gaggcccggcctgtgcctgctccgaaagcaccggccccccagtctgcgccacaggctgca
gggccttccctgggagctcggcaagaatcggacacaagcagcagtgacagcgaggaagat
gttatttttgtttcctctcagcctgggtacccctcactctcagacaggacttcagactca
cggaagaaggagaacctccaattccctggtcatactgggcaaagaaaaatgtctcccgcc
tcaggtgctcccaagaaggtagaaccttcagacccagcagcccaacgtgcatacctcaca
acacaactgaaacaaaagaagagcacactggcatcagtgaacattcaggttcttccagac
aaaggtcagaagttgttgaagcagattcaggagttggaggaagcactcggtgctcttgcc
ctctccccagagcaaggtgctgatgagaagaataacactgaagtaccacaacagagtaac
ttcactgaaactaccactactcctccccacttggtgccacccaaacccctgcagggtcag
gctcaccagcatctgggttctctaggactgaaggctgcctgccaggtagctgctggacag
tctagtcagtgcttcagaggccctgcgaaccaagatcgccttcaggccgtgtggaaaatc
acaagtgaagccattgatgcgctgcaccgatccctcgagtcatgtcccggtgaggcagct
gtggcagaggatccagctgggttgaaggtccctttgctactgcaccaaaagcaggcatta
gcctggctactgtggcgagaaagtcagaagccacaaggaggaattctggcggacgatatg
gggttaggaaaaaccctgacaatgatcgcgctcattctgacccagaaggaccgagtggaa
aacagagaaaaggacaacagcgcgcccttgacttggctttccaaagacgaccccactgag
tttacttcccatggaacacttgtcgtctgtcctgcttccctgatccatcattggaaaaag
gaggtggagaaacgtgtgagccgcagcagactcagagtctgtctctatcatgggccagac
cgggatcagcgtgcaagagtcctctctacatatgacatcgtgatcaccacatacagcatt
ctggccagggagatccccacagagaagcaagagggactggccccaagcacaaacctcagt
gaagaggaaatctcaacgcctttgcttcgcatagtctgggcacgaatcatcctggatgaa
gctcacaatattaagaacccccgagtgcagacttccatagctgtgtgtaagctgcaagct
catgcccgttgggctgtcactggaacccccattcagaacaacctgctggacatgtattca
ctgctaaagttcctccgctgttctccatttgaccagttcagtctgtggaagagccaggtt
gacaatgatacaaagaaaggaggtgaacggttaagtattttaaccaagagccttttgcta
cggagaacaaaagaccagctggactccaccggaaagcccttggtggtgctgccccagcgt
aaatttcagttgcaccatttgaaactttctgaagatgaagagatggtttacagtgtcctt
tttgcaagatcaaggtcagctctacaatcctatctaaaaagacaggaaggtggggacagc
caatctggacgaagccctgataatccattcagtagagtggcacaggagtttgggtccagt
gggcctgggcgctctgtggccgcagactcacagaaatccagcaccgcccacatattgtca
cagttgctgagactccgccagtgttgctgtcatctctctttgctgaagtcggccctggat
ccgacagagctgaagagcgaaggcctgctcctttccctggaggaccagctcaacgctttg
accttgtccgaactccagaactcagagccagcttccactgtttccctgaatggcgagtgc
ttcccggcggagctttttgaagacacgagagagagcaccaagatttcatctctgttggca
gagctggaggcgatccaaagaaattccggatctcaaaagagtgtcattgtctctcagtgg
accagcatgctgaaggttgtagcgttgcacctgcggaggcacagactgacttacgccacc
atcgacggctctgtcagccccaaacagagaatggatttggtagaggcatttaacaactcc
aggggccctcaggtcatgctgatctcgcttttggctggaggtgttggtctaaacctgact
ggagggaaccatctttttcttctggatatgcactggaacccatcacttgaagatcaagct
tgcgaccgaatttaccgagtagggcagcagaatgacgtcgtcatccacagatttgtttgt
gaagaaacagtggaagagaagatcttgcagctccaagagaaaaagaaagatttggctaga
cagattctatcaggatctggagaatctgtcaccaagctcaccttggctgacctcaaagtc
ctttttggcatctaa

DBGET integrated database retrieval system