KEGG   Miniopterus natalensis: 107545406
Entry
107545406         CDS       T05883                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04115  p53 signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107545406 (PMAIP1)
   04215 Apoptosis - multiple species
    107545406 (PMAIP1)
   04115 p53 signaling pathway
    107545406 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545406 (PMAIP1)
   05203 Viral carcinogenesis
    107545406 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107545406 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107545406 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 107545406
NCBI-ProteinID: XP_016078975
LinkDB
Position
Unknown
AA seq 64 aa
MAVRMQEIVYREPRALPSARPSPGSSSPLEVEAECALQLKRIGDRLSFHQKLLNLLSKLY
HSGT
NT seq 195 nt   +upstreamnt  +downstreamnt
atggctgtgagaatgcaggagattgtgtacagggaaccccgggcactgccttctgcccgc
ccgagcccgggcagctcatccccgctcgaggtcgaggccgagtgcgcccttcaattgaag
agaattggagacagactaagtttccaccagaaacttctgaatctgctgtctaagctctac
cactcgggaacctga

DBGET integrated database retrieval system