KEGG   Miniopterus natalensis: 107545431
Entry
107545431         CDS       T05883                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04064  NF-kappa B signaling pathway
mna04066  HIF-1 signaling pathway
mna04071  Sphingolipid signaling pathway
mna04115  p53 signaling pathway
mna04140  Autophagy - animal
mna04141  Protein processing in endoplasmic reticulum
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04261  Adrenergic signaling in cardiomyocytes
mna04340  Hedgehog signaling pathway
mna04510  Focal adhesion
mna04621  NOD-like receptor signaling pathway
mna04630  JAK-STAT signaling pathway
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04915  Estrogen signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05014  Amyotrophic lateral sclerosis
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05162  Measles
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05215  Prostate cancer
mna05222  Small cell lung cancer
mna05226  Gastric cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107545431 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107545431 (BCL2)
   04630 JAK-STAT signaling pathway
    107545431 (BCL2)
   04064 NF-kappa B signaling pathway
    107545431 (BCL2)
   04066 HIF-1 signaling pathway
    107545431 (BCL2)
   04071 Sphingolipid signaling pathway
    107545431 (BCL2)
   04151 PI3K-Akt signaling pathway
    107545431 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107545431 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    107545431 (BCL2)
   04215 Apoptosis - multiple species
    107545431 (BCL2)
   04217 Necroptosis
    107545431 (BCL2)
   04115 p53 signaling pathway
    107545431 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107545431 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107545431 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107545431 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    107545431 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545431 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    107545431 (BCL2)
   04722 Neurotrophin signaling pathway
    107545431 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545431 (BCL2)
   05206 MicroRNAs in cancer
    107545431 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107545431 (BCL2)
   05226 Gastric cancer
    107545431 (BCL2)
   05215 Prostate cancer
    107545431 (BCL2)
   05222 Small cell lung cancer
    107545431 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107545431 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    107545431 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107545431 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107545431 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107545431 (BCL2)
   05152 Tuberculosis
    107545431 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107545431 (BCL2)
   05161 Hepatitis B
    107545431 (BCL2)
   05162 Measles
    107545431 (BCL2)
   05168 Herpes simplex virus 1 infection
    107545431 (BCL2)
   05169 Epstein-Barr virus infection
    107545431 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545431 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107545431 (BCL2)
   01524 Platinum drug resistance
    107545431 (BCL2)
   01522 Endocrine resistance
    107545431 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107545431 (BCL2)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107545431 (BCL2)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 107545431
NCBI-ProteinID: XP_016079003
LinkDB
Position
Unknown
AA seq 125 aa
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIA
LWMTEYLNRHLHTWIQDNGGWDAFVELYGPNMRPLFDFSWLSLKALLSLALVGACITLGA
YLGHK
NT seq 378 nt   +upstreamnt  +downstreamnt
atgtccagccagctgcacctgacgcccttcaccgcgaggggacgctttgccacggtggtg
gaggagctcttcagggacggggtgaactgggggaggattgtggccttctttgagttcggt
ggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacaacatcgcc
ctgtggatgacggagtacctgaaccggcacctgcacacctggatccaggataacggaggc
tgggacgcctttgtggaactgtacgggcccaacatgcggcctctgttcgacttctcctgg
ctgtccctgaaggcgctgctcagcctggccctggtgggagcttgcatcaccctgggtgcc
tatctgggccacaagtga

DBGET integrated database retrieval system