KEGG   Miniopterus natalensis: 107545566
Entry
107545566         CDS       T05883                                 

Gene name
TYRP1
Definition
(RefSeq) 5,6-dihydroxyindole-2-carboxylic acid oxidase
  KO
K00506  tyrosinase-related protein 1 [EC:1.14.18.-]
Organism
mna  Miniopterus natalensis
Pathway
mna00350  Tyrosine metabolism
mna01100  Metabolic pathways
mna04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107545566 (TYRP1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107545566 (TYRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545566 (TYRP1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.-  
     107545566 (TYRP1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   107545566 (TYRP1)
SSDB
Motif
Pfam: Tyrosinase LST1 Sigma_reg_N
Other DBs
NCBI-GeneID: 107545566
NCBI-ProteinID: XP_016079159
LinkDB
Position
Unknown
AA seq 536 aa
MEVHKLLSLGYILSLLFIQQAWAQFPRECATTEALRNGVCCPDLSPVSGPGTDPCGSSSG
RGRCEAVTADSRPHSPQYPHDGRDDREAWPTRFFNRTCRCNGNFSGHNCGTCRPGWRGTA
CDQRVLTVRRNILDLSTEEKNYFVQALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFEN
ISIYNYFVWTHYYSVKKTFLGTGQESFGEVDFSHEGPAFLTWHRYHLLQLEEDMQEMLQN
PSFSLPYWNFATGKNVCDICTDDLMGSRSNFDPNLISPNSVFSQWRVVCESLEDYDTLGT
LCNSTEGGPIRRNPAGNVARPMVQRLPKPQDITQCLEVGLFDTPPFYSNSTNSFRNTVEG
YSDPTGRYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPVFILLHTYTDAIFDEWLRRYNAD
ISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEVQWPSRSFRISEIITI
AVIAALLLVAVIFVGASCLIRARNNMDEANQPLLTDQYRHYAEEYEKLPNPNQSVV
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggaagttcataaactcctctctttaggatacatcttgtccctgctttttattcagcag
gcttgggctcagtttccaagagagtgtgccaccactgaggctttgagaaatggtgtgtgc
tgcccagacctgtcccctgtgtcggggcctgggactgacccctgcggctcctcctcaggg
aggggcaggtgtgaggcagtgactgcagactcccgaccccacagcccccagtacccgcat
gatggccgggatgatcgagaggcctggcccacacgtttcttcaacaggacatgtcgctgc
aatggcaacttctcaggacacaactgtgggacttgccgtcctggatggagaggaactgcc
tgtgaccagagggttctcacagtcaggagaaacattctggacttaagtacagaagaaaag
aactactttgtccaggccctggatatggcaaagcgtacaactcaccctctgtttgtcatt
gccaccagaagatcagaagaaatactggggccagatggcaacacaccacaatttgagaac
atttcaatttataactactttgtttggacacactattattcagtcaaaaagactttcctt
ggcacaggacaggaaagctttggtgaagtggatttctcccatgaaggaccagcttttctc
acctggcacaggtatcacctactgcagttggaggaggacatgcaggagatgctacagaat
ccctcgttctcccttccttactggaattttgcgactgggaagaatgtttgtgatatctgc
actgatgacttgatgggatcaagaagcaactttgatcccaatcttataagcccgaactct
gtcttttcccaatggcgagtggtctgcgaatccttggaagattatgacaccctaggaacc
ctttgtaacagcactgaaggcgggccaattaggaggaatccagcaggaaatgtggctaga
ccaatggtgcaacgtcttcctaagccacaggatatcactcagtgcttggaagtcggttta
tttgacacacctcctttttattccaattctacaaacagtttccgaaacacagtggaaggt
tacagcgatcccacaggaaggtatgaccctgctgttcgaagccttcacaatttggctcat
ctgttcctgaatggaacagggggacaaacccatctgtctccaaatgaccctgtattcatc
ctcctgcatacttacaccgatgccatctttgacgaatggctgaggagatacaatgctgat
atatccacatttccattggaaaacgcccctattggacataatagacaatataatatggtg
ccattctggcctccagttaccaatacagaaatgtttgttactgctccagacaacctggga
tatacttatgaagttcaatggccaagtcggagttttcgtatttctgagattattaccata
gcagtgattgcagctttattactggttgcagtcatttttgtgggtgcttcttgtctgatt
cgagccagaaacaatatggatgaagccaatcagcctctcctcactgaccagtatcgacac
tatgccgaagaatatgaaaaactcccgaatccgaatcaatctgtggtctaa

DBGET integrated database retrieval system