KEGG   Miniopterus natalensis: 107545578
Entry
107545578         CDS       T05883                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna01524  Platinum drug resistance
mna04012  ErbB signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04115  p53 signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04218  Cellular senescence
mna04630  JAK-STAT signaling pathway
mna04921  Oxytocin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05211  Renal cell carcinoma
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107545578 (CDKN1A)
   04630 JAK-STAT signaling pathway
    107545578 (CDKN1A)
   04066 HIF-1 signaling pathway
    107545578 (CDKN1A)
   04068 FoxO signaling pathway
    107545578 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    107545578 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107545578 (CDKN1A)
   04115 p53 signaling pathway
    107545578 (CDKN1A)
   04218 Cellular senescence
    107545578 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107545578 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    107545578 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545578 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    107545578 (CDKN1A)
   05206 MicroRNAs in cancer
    107545578 (CDKN1A)
   05205 Proteoglycans in cancer
    107545578 (CDKN1A)
   05203 Viral carcinogenesis
    107545578 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107545578 (CDKN1A)
   05212 Pancreatic cancer
    107545578 (CDKN1A)
   05225 Hepatocellular carcinoma
    107545578 (CDKN1A)
   05226 Gastric cancer
    107545578 (CDKN1A)
   05214 Glioma
    107545578 (CDKN1A)
   05216 Thyroid cancer
    107545578 (CDKN1A)
   05220 Chronic myeloid leukemia
    107545578 (CDKN1A)
   05217 Basal cell carcinoma
    107545578 (CDKN1A)
   05218 Melanoma
    107545578 (CDKN1A)
   05211 Renal cell carcinoma
    107545578 (CDKN1A)
   05219 Bladder cancer
    107545578 (CDKN1A)
   05215 Prostate cancer
    107545578 (CDKN1A)
   05213 Endometrial cancer
    107545578 (CDKN1A)
   05224 Breast cancer
    107545578 (CDKN1A)
   05222 Small cell lung cancer
    107545578 (CDKN1A)
   05223 Non-small cell lung cancer
    107545578 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107545578 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107545578 (CDKN1A)
   05161 Hepatitis B
    107545578 (CDKN1A)
   05160 Hepatitis C
    107545578 (CDKN1A)
   05163 Human cytomegalovirus infection
    107545578 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107545578 (CDKN1A)
   05169 Epstein-Barr virus infection
    107545578 (CDKN1A)
   05165 Human papillomavirus infection
    107545578 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107545578 (CDKN1A)
   01522 Endocrine resistance
    107545578 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107545578
NCBI-ProteinID: XP_016079165
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSQDARPIPRGSKACRRLFGPVDSEQLRRDCNALMASCVQEACDRWNFDFVTETPLE
GDYVWERVWGLGLPKLYVPSGPRGAQDNLGGGKQASSSPALLQGTAQEDHVDLSLSCTLI
PCSSERPEGSPGGPSMSQGRKRRQTSMTDFYHSKRRLILSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccatcccaggatgcccgcccgatcccccgtggcagcaaggcctgccgtcgc
ctgttcggcccagtggacagtgagcagctgcgccgagactgcaatgcactaatggccagc
tgcgtccaggaggcctgtgatcgatggaacttcgactttgtcaccgagacaccactggag
ggtgactacgtctgggagcgtgtgtggggcctgggcctgcccaagctctacgtgccctca
gggccgcggggggcccaggacaacctgggaggaggcaagcaggccagcagctcacctgcc
ctgctgcaggggacagctcaggaggaccacgtggacctgtcactgtcctgcaccctcatc
ccttgctcctccgagcggcctgaggggtccccaggtgggcctagcatgtctcagggccga
aaacgacggcagaccagcatgacagatttttatcactccaaacgccggctgatcttgtcc
aagaggaagccctaa

DBGET integrated database retrieval system