KEGG   Miniopterus natalensis: 107545625
Entry
107545625         CDS       T05883                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04080  Neuroactive ligand-receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04630  JAK-STAT signaling pathway
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107545625 (GHR)
   04151 PI3K-Akt signaling pathway
    107545625 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107545625 (GHR)
   04060 Cytokine-cytokine receptor interaction
    107545625 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107545625 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107545625 (GHR)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  Prolactin receptor family
   107545625 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 Interfer-bind DUF3149
Other DBs
NCBI-GeneID: 107545625
NCBI-ProteinID: XP_016079232
LinkDB
Position
Unknown
AA seq 636 aa
MDLWKLLLTLAVAGSSDAFSGSEAIPAALDQASQNLQRVHPGPATNSSGTPRFTKCRSPE
LETFSCHWTDGVHHGFGSPGHVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNASYTS
IWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPTGLNWTLLNISLTGIHADIQVRWEPPSN
ADVQKGWIVLEYELQYRETNETQWKMMDPVLSTSVPVYSLRLDKQYEVRVRSRQRNSDKY
GEFSEVLVVSLPQMSPLACDEDFRFPWFLIIIFGMFGLIVIFLLMFSKQERIKMLILPPV
PVPKIKGIDPGLFKEGKLEEVNTILAVHDSCKPEFCNDDSWVEFIELDIDDPDEKTDGSD
TDRLLRDDHQKLLNILGAKDDDSGRTSCYDPDILEADFQASDLGDGALEAAQPQRLKGEA
DLLCLDAKNRTDPPPRAAAPAAQEPGVGLAQEDKPRPLFGETESTHQAAHPQLNNPSSVA
NIDFYAQVSDITPAGSVVLSPGQKHKAGTAPCAAHPEVGAPCQANFLTDSAYFCEADATK
CIAGAPPGELGARGAPSFNQEDTYITTESLTTTARRPGAAGGAPGSQTPVPDYTSIHIVQ
SPQGLILNATASPRPDKEFLSACGYVSADQLDNIMP
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggatctctggaagttgctattgaccttggcagtggctggctccagtgatgctttttct
gggagtgaagccataccagctgccctcgaccaagcatcccagaacctacagagagttcat
cctggcccagcgacaaactcttctgggacgcccaggttcaccaagtgccgttcgcctgaa
ctggagacgttttcatgccactggacagacggggttcatcacggtttcgggagcccggga
cacgtacagctgttctacattagaaggaacactcaagaatggactcaggaatggaaagaa
tgccctgactatgtctctgcgggagaaaacagctgttacttcaatgcgtcgtatacctcc
atctggataccctactgtatcaaactcactagcaacggcggtaccgtggatcaaaagtgc
ttctctgtcgaggaaatagtacaaccagatccacccacgggcctcaactggaccttactg
aacatcagcctgaccgggatccacgcggatatccaagtgcgatgggagccgccatccaat
gcagatgttcagaaagggtggatcgtcctggagtacgagctgcaatacagagagaccaac
gagacccagtggaaaatgatggaccctgtgctgtcaacatccgtcccagtgtactcgctg
aggctcgacaaacagtacgaggttcgcgtgcgctccaggcagcggaactcggacaaatac
ggcgagttcagcgaggtcctcgtcgtctcgctcccccagatgagcccgctggcgtgtgac
gaagatttccggtttccgtggttcttaattattatctttggaatgtttgggctgatcgtg
atatttttactcatgttttctaaacaggaaaggattaagatgctgattctgcccccagtt
ccagttccaaagattaaaggaatcgatccaggcctcttcaaggaagggaaactggaggag
gtgaacacaatcttagccgttcacgacagctgcaagcctgaattctgcaacgacgactcc
tgggttgagttcattgagctggatatcgacgaccctgatgagaagacggacgggtccgac
acagacaggcttctccgcgacgaccatcagaaattacttaacatccttggggcgaaggat
gacgactcgggacgtaccagctgctacgaccctgacatcctggaggccgacttccaggcc
agtgacctgggcgacggtgccttggaggccgcgcagccccagaggttaaagggggaagca
gatctcttgtgccttgacgcgaagaaccggaccgacccgccgccgagggctgcggcccct
gccgcgcaggagcccggtgttggcctcgcccaggaagacaaaccaagaccactttttggg
gaaactgagtcaacccaccaagccgcccatcctcagctgaacaatccgagttcagtggca
aacattgacttttacgcccaggtaagcgacatcacgccagcagggagtgtggtcctctcc
ccgggccaaaagcataaggcagggacagccccgtgcgccgcgcatcccgaggtgggcgcc
ccctgccaagcaaacttcctcacggacagcgcctacttctgcgaggcggacgccaccaag
tgcatcgccggggccccgcccggggagctgggggcgcggggggcgccaagctttaaccag
gaggacacctacatcaccacagaaagccttaccactactgctcggaggcctggggcggca
ggaggggcgccgggctcccagacgcccgtcccagactacacctccatccacatagtccag
tccccgcagggcctgatcctcaacgccaccgcgtcgccccggcccgacaaggagttcctc
tcggcctgtggctacgtgagcgccgaccagctggacaacatcatgccctag

DBGET integrated database retrieval system