KEGG   Miniopterus natalensis: 107545900
Entry
107545900         CDS       T05883                                 

Gene name
ABCC4
Definition
(RefSeq) multidrug resistance-associated protein 4
  KO
K05673  ATP-binding cassette, subfamily C (CFTR/MRP), member 4
Organism
mna  Miniopterus natalensis
Pathway
mna01523  Antifolate resistance
mna02010  ABC transporters
mna04024  cAMP signaling pathway
mna04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107545900 (ABCC4)
  09132 Signal transduction
   04024 cAMP signaling pathway
    107545900 (ABCC4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107545900 (ABCC4)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107545900 (ABCC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107545900 (ABCC4)
Transporters [BR:mna02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    107545900 (ABCC4)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 MMR_HSR1 AAA_29 RsgA_GTPase Dynamin_N AAA_21 AAA_23 AAA_7 T2SSE DUF87 ABC_ATPase
Other DBs
NCBI-GeneID: 107545900
NCBI-ProteinID: XP_016079635
LinkDB
Position
Unknown
AA seq 1282 aa
MYSVLPQDRSKHLGEELQGYWDKEVLKAKSDSRKPSLTKAIIKCYWKSYAILGIFTLIEE
GTKVVQPLFLGKIISYFENYDPTDSAALREAYAYATVLTTCTLLLAILHHLYFYHVQCAG
MRLRVAMCHMIYRKALRLSNVAMGKTTTGQIVNLLSNDVNKFDQVTIFLHFLWAGPLQAI
AVTALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSLRSKTATFTDVRIRTMNEVITGI
RIIKMYAWEKPFAELITSLRRKEISNILKSSYLRGMNLASFFVASKIIVFVTFTTYVLLG
NVIRASHVFVAVTLYGAVRLTVTLFFPSAIEKVSEAIVSIRRIKNFLLLDEIKQGSPELP
PDGKGIVQVQDFTAFWDKVSEIPTLQDLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELA
PSQGLVTVHGKIAYASQQPWVFSGTVRSNILFGKKYEKERYEKVIKACALKKDLELLEDG
DLTVIGDRGATLSGGQKARINLARAVYQDADIYLLDDPLSAVDAEVGRHLFQLCICQTLH
EKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGVDFGSLLKKDNDEVEQASI
SGSPKLRHRTFSESSIWSQQSSRASLKDGAPESQPVENVQVAVSEESRSEGKVGLKAYKN
YFIAGAHWFIIIFLILVNIVAQVSYVLQDWWLSYWANEQSALNVTVNGKGNVTEKLDLNW
YLGIYSGLTAATVVFGIARSLLVFHVLVKSSQSLHNKMFESILKAPVLFFDRNPVGRILN
RFSKDIGHMDDLLPLTFLDFIQTFLQVTGVVGVAVAVIPWIAIPLVPLGIVFFVLRRYFL
ETSRDVKRLESTTRSPVFSHLSSSLQGLWTIRAYKTEERFQELFDAHQDLHSEAWFLFLT
TSRWFAVRLDAICAMFVIVVAFGSLILAKTLDAGQVGLALSYALTLMGMFQWCIRQSAEV
ENMMISVERVMEYTDLEKEAPWEYQKRPPPTWPHEGVIVFDNVNFTYSLDGPLVLKHLTA
LIKSREKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQE
PVLFTGTMRKNLDPFNEHTDEELWNALKEVQLKEAIEDLPGKMDTELAESGSNFSVGQRQ
LVCLARAILRKNRILIIDEATANVDLRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDK
IMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPDITQN
GHVVVNASNGQPSTFTIFETAL
NT seq 3849 nt   +upstreamnt  +downstreamnt
atgtactcagtgcttccacaagatcgctcaaagcaccttggagaagagttgcaagggtac
tgggataaagaagtcttgaaagccaagagtgactctcggaagccatctttaacaaaagca
atcatcaaatgttactggaaatcctatgcaattttgggaatttttacattaattgaggaa
ggcaccaaagtagtccagcccctatttttggggaaaattattagttattttgaaaactat
gatcccaccgattctgcagctttgcgtgaagcctacgcctacgccacggtgctgactacc
tgcacgcttcttttggccatactgcatcacctgtacttttatcacgttcagtgtgctggc
atgaggttaagagtagccatgtgccatatgatttatcggaaggctcttcgccttagtaac
gtggccatgggcaagaccaccacaggccagatcgtcaatttgctgtccaatgatgtgaac
aagtttgatcaggtaacaatattcttgcactttctgtgggcaggcccactgcaggccatc
gcagtgaccgccctgctgtggatggaaataggaatctcgtgtcttgccgggatggcagtg
ctaattattcttctgcctttgcaaagctgcttcggaaagttgttctcatcactccggagt
aagaccgcaacattcacagatgtcaggatcagaaccatgaatgaagttatcactggcata
agaataataaaaatgtatgcttgggaaaagccatttgcagagcttattaccagtttgagg
aggaaggaaatttccaatattctgaaaagttcctaccttagaggaatgaatttggcatca
tttttcgttgcaagcaaaatcatcgttttcgtgaccttcactacctatgtgctccttggc
aatgtgatcagagccagccatgtgtttgtggcggtgacgctctatggggccgtgcggttg
actgtcaccctcttcttcccctcggccatcgagaaggtgtcagaggccatcgtcagcatc
cgaaggatcaagaactttctgttgcttgatgagataaaacagggcagccctgagctgcct
ccagatggtaaagggatagtgcaagttcaagattttactgctttttgggataaggtatca
gaaatcccaaccctgcaagacctttccttcactgtcagacccggtgaactgttagctgtg
gttggacctgtgggagcaggaaagtcgtcactgttaagtgctgtgctgggagaattggcc
ccgagccaggggctggtcactgtgcatggaaagatcgcatatgcttctcagcagccctgg
gtgttttcaggaactgtgaggagcaatattttatttgggaagaaatatgaaaaggaacga
tacgaaaaagtaataaaggcctgtgctttgaaaaaagatttggagcttttggaagatgga
gatctaacggtgataggagatcggggagccacgctgagcggagggcagaaagcccgcatt
aacctcgccagagcagtgtatcaggatgcagacatttaccttctggacgatcccctcagc
gccgtagatgcagaagttggcaggcacttgttccagctgtgtatttgtcaaaccttgcac
gagaagatcacaatcttagtgactcaccagttgcagtacctaaaagctgcgagtcagatt
ctgatattgaaagatggtaaaatggtgcaaaaggggacttacactgagtttctgaaatcg
ggggtggattttggttcccttttgaagaaggacaatgatgaggtggagcaggcttccatc
tcgggaagtcccaagctgaggcaccggaccttctcggagtcttccatttggtctcagcag
tcttctagagcttcgttgaaagatggtgccccagagagccaaccggttgagaatgtgcag
gttgcagtaagcgaggagagccgttctgaaggaaaagttggtcttaaggcctacaagaac
tactttatagccggtgctcactggtttatcatcattttccttattctagtaaacattgtg
gcccaggtttcctacgttcttcaggattggtggctgtcatactgggcaaatgaacagagc
gccctgaacgtcaccgtaaatggaaaaggaaatgtaactgagaagctcgatcttaactgg
tacttgggaatttactcaggtttaactgcagctaccgtcgttttcggcatagcaagatct
ctgttggtattccacgtcctcgttaagtcttcacaaagtttacacaacaaaatgtttgag
tccattttgaaagctccggtattgttctttgatagaaacccagtaggaagaattctaaat
cgtttctccaaagacattggacatatggatgacttgctgcccctgacatttctagatttc
atccagacatttctgcaagtgactggtgtggtaggcgtggcggtggctgtgattccttgg
attgcaatacctctggttccccttggcatcgttttctttgttcttcggagatacttctta
gaaacgtcaagagatgtcaaacgcctggaatctacaacccggagcccggtgttttcccac
ctatcatcttctctccagggactctggaccatccgggcctacaaaaccgaagagaggttt
caggaactctttgatgcacatcaggatttgcattcagaggcttggttcttgttcctgacc
acgtcccgatggttcgccgtgcgtctggatgccatctgtgccatgtttgtcatcgttgtt
gcctttgggtccctgattctggccaaaactctggatgccgggcaggttggcctggcgttg
tcctacgccctcaccctcatggggatgttccagtggtgcatcaggcagagcgccgaagtt
gagaatatgatgatttccgtagagagggtgatggaatacacagaccttgagaaagaagcg
ccttgggaataccaaaaacgccctccgcccacctggccccacgaaggagtgattgtcttt
gacaacgttaacttcacatacagtctagatgggcctctggtactgaaacacctgacagcg
ctcattaaatcaagagaaaaggttggcattgtgggaagaacaggagctggaaaaagttcc
ctcatctcagccctttttagattgtcagaacctgaaggtaaaatttggattgataagatc
ttgacaactgaaattggacttcacgatttaaggaagaaaatgtcaatcatacctcaggaa
cctgttttattcactggaacgatgaggaaaaatctggatccctttaatgagcatacggat
gaggagctgtggaatgccttaaaagaggtacaacttaaagaagccattgaagaccttcct
ggtaaaatggataccgaattagcagaatccggatcgaacttcagtgtcggacagagacag
ttggtgtgccttgccagagccattctcaggaaaaatcggatattgatcattgacgaggca
acagcaaatgtggatctcagaactgatgagttaatacaaaaaaaaatccgtgagaaattt
gcccattgcactgtgctaaccattgcacacaggttgaacaccattattgacagtgacaag
attatggttttggattcaggaagactgaaagaatatgatgagccctatgttttgctgcaa
aataaagagagcctattttacaagatggtgcaacaactgggcaaggcagaagctgccgcc
ctcaccgaaacagcaaaacaggtgtacttcaaaaggaattacccagatattactcagaac
ggccacgtggttgtgaacgcttccaacggccagccctccaccttcactatttttgagaca
gcgctgtga

DBGET integrated database retrieval system