KEGG   Miniopterus natalensis: 107545906
Entry
107545906         CDS       T05883                                 

Gene name
DCT
Definition
(RefSeq) L-dopachrome tautomerase
  KO
K01827  dopachrome tautomerase [EC:5.3.3.12]
Organism
mna  Miniopterus natalensis
Pathway
mna00350  Tyrosine metabolism
mna01100  Metabolic pathways
mna04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107545906 (DCT)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107545906 (DCT)
Enzymes [BR:mna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.12  L-dopachrome isomerase
     107545906 (DCT)
SSDB
Motif
Pfam: Tyrosinase
Other DBs
NCBI-GeneID: 107545906
NCBI-ProteinID: XP_016079646
LinkDB
Position
Unknown
AA seq 524 aa
MSPLWWALLLSCLGCGLPPRARAQFPRVCMTVASLASKECCPPLGAEPANVCGSQEGRGR
CSEARADTRPWGGPYFLRNQDDRERWPRKFFNRTCNCTGNFAGYNCGDCKFGWTGPDCDQ
KKPLVIRKNIHSLTPQEREQFLGALDLAKNTTHPDYVITTQHWLTLLGPNGTQPQIANCS
IYDFFVWLHYYSVRDTLLGPGHPYKAIDFSHQGPAFVTWHRYHLLWLERDLQRLIGNESF
ALPYWNFATGRNECDVCTDQLLGAARQDDPTLISQNSRFSSWEIVCDSLDDYNRRVTLCN
GTYEGLLRRNQVGRNGEKLPSLKDVQNCLSLNKFDNPPFFQNSTLSFRNALEGFNKADGT
LDSQVMNLHNLVHSFLNGTNAFPHSAANDPVFVVLHSFTDAIFDEWMRRFNPSVDAWPQE
LAPIGHNRMYNMVPFFPSVTNQEFFKTADQLGYNYAIDLPVEETPSSTTTLPVVMGTLAA
LVALLALLAFLQYRRLRKGYAPLMETHLNNKRYTEEAYGAHALP
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgagccctctttggtgggcgcttctgctcagctgcctgggctgcgggctcccgcccagg
gcccgggcgcagttcccccgggtctgcatgacggtggccagcctggcgtccaaggagtgc
tgcccgcccctgggtgcggagccggcaaacgtctgcggctctcaggagggccgcggccgc
tgctcggaggcgcgggccgacaccaggccctggggcgggccttacttcctgaggaaccag
gacgaccgcgagcggtggccacggaagttcttcaaccggacctgcaactgcacaggaaac
tttgctggctataactgtggagactgcaagtttggctggaccggccccgactgcgatcag
aagaaaccactggttattcgaaagaacattcattctttgactcctcaggagagggagcag
ttcttgggtgccttagaccttgcgaagaacaccacacacccggactacgtgatcactacg
caacactggctgactctgcttgggcccaatgggactcagccacagatcgccaactgcagc
atttatgatttctttgtgtggctccattactattctgttagagatacattattaggacca
gggcacccatacaaggccattgatttctcacaccaaggacctgcctttgtcacctggcac
cggtatcatttgttgtggctggaaagagatctccagcgacttattggcaacgagtccttt
gctttgccctactggaattttgccactgggaggaacgagtgtgacgtgtgtacagaccaa
ctgcttggggcagcaagacaagatgatccgactctgattagtcagaactcaagattctcc
agctgggaaattgtctgtgatagcttagatgactacaaccgccgggtcactctgtgtaat
ggaacctatgaaggtttgttgagaagaaatcaagtgggaagaaatggtgagaagttgcca
tccttaaaagatgtacaaaattgtctgtctctcaacaagtttgacaaccctcctttcttc
cagaactccaccttgagcttcaggaatgccctggaggggtttaataaagcagatgggacc
ctggactctcaagtgatgaaccttcataatttggttcactctttcctgaacgggacaaat
gcttttccacattctgctgccaatgatcctgtttttgtggtcctccattcctttactgat
gccatttttgatgagtggatgagaagatttaatccttctgtagatgcttggcctcaggag
ctggcacccattggtcacaaccggatgtacaacatggttcctttctttccttcggtgact
aatcaggaattctttaaaaccgcagaccagcttggctacaactacgccattgacctgcca
gttgaagaaactccaagttctaccacgactctcccagtggttatgggaacgctggcagct
ttggttgcccttttggcgctgctggctttccttcagtacagaagacttcgcaaaggatat
gcacccttaatggagacacatttaaacaacaaaagatacacagaagaagcctacggtgct
cacgccttaccctag

DBGET integrated database retrieval system