KEGG   Miniopterus natalensis: 107546245
Entry
107546245         CDS       T05883                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna04064  NF-kappa B signaling pathway
mna04370  VEGF signaling pathway
mna04625  C-type lectin receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04668  TNF signaling pathway
mna04723  Retrograde endocannabinoid signaling
mna04726  Serotonergic synapse
mna04913  Ovarian steroidogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05140  Leishmaniasis
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05200  Pathways in cancer
mna05204  Chemical carcinogenesis
mna05206  MicroRNAs in cancer
mna05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107546245 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107546245 (PTGS2)
   04064 NF-kappa B signaling pathway
    107546245 (PTGS2)
   04668 TNF signaling pathway
    107546245 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107546245 (PTGS2)
   04657 IL-17 signaling pathway
    107546245 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107546245 (PTGS2)
   04913 Ovarian steroidogenesis
    107546245 (PTGS2)
   04921 Oxytocin signaling pathway
    107546245 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    107546245 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    107546245 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107546245 (PTGS2)
   05206 MicroRNAs in cancer
    107546245 (PTGS2)
   05204 Chemical carcinogenesis
    107546245 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107546245 (PTGS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107546245 (PTGS2)
   05022 Pathways of neurodegeneration - multiple diseases
    107546245 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107546245 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107546245 (PTGS2)
   05165 Human papillomavirus infection
    107546245 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107546245 (PTGS2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107546245 (PTGS2)
SSDB
Motif
Pfam: An_peroxidase EGF
Other DBs
NCBI-GeneID: 107546245
NCBI-ProteinID: XP_016080072
LinkDB
Position
Unknown
AA seq 704 aa
MHLGGSSQGGRTFLDVVQSLTIGDEAYEDGEFSSTHRCTQCRWKSASDSRPELVSNKISQ
QGADLQPFLISRDKSGVESSGTFGNPRSLYGPLKAQCLVPGADRVLLSPYQPGGRLGANP
CCSNPCQNQGVCMSVGFDQYQCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTH
FRGVWNIVNNIPFLRNAIMKYVLTSRSHLVDSPPTYNAHYGYKSWESFSNLSYYTRVLPP
VADDCPTPMGVKGKKELPDTEVLLDKFIIRRKFIPDPQGTNLMFAFFAQHFTHQFFKTDH
KRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKYQLIDGEVYPPTVRDTQVEMI
YPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWDDERLFQTSRL
ILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAEFNTLYHWHPLLPDT
FHIDDQEYSYPQFVYNNSLLMEHGLTQFVESFSKQIAGRVAGGRNLPAAVRYVAKASINH
SRHMKYQSLNEYRKRFRMKPYESFEELTGEKEMAAELEALYGDIDAMELYPALLVEKPRP
DAIFGETMVELGAPFSLKGLMGNPICSPHYWKPSTFGGEVGFKIINTASIQSLICNNVKG
CPSTSFSVQNPAPAKTVTMSASPSHSRLDDISPTVLLKGRSAEL
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgcacctgggtggcagcagtcagggtggcaggacttttttggacgtggtccagagtcta
acaattggagatgaagcttatgaagatggagagtttagctctactcacaggtgtacacag
tgtcgctggaagtcagccagcgactcaagaccagagctcgtgtcaaataaaatctcacaa
cagggagcagacttgcagccatttctgatttccagagacaagagtggcgtcgaatccagt
ggcaccttcgggaatccccgttccctgtatgggccgctcaaggcacaatgcctggtgccc
ggcgctgacagagtgctgctttctccataccaacctggagggcgtcttggggcaaatcct
tgctgttccaacccatgccaaaaccaaggcgtgtgtatgagtgttggattcgaccagtac
cagtgtgactgtacccggacaggattctacggtgaaaactgttcaacacctgaatttctg
acaagaataaagttattcctgaaacccacgccgaacacggtgcactacatactcacccac
ttcaggggcgtctggaacattgtcaataacattcccttcctgagaaatgcaatcatgaaa
tacgtgttgacgtccagatcacatttggttgacagcccaccgacttacaatgcacactat
ggctataaaagctgggaatccttttctaacctctcctattacaccagagttcttcctcct
gtggctgatgactgcccaactcccatgggtgtgaaaggaaagaaagagcttcctgataca
gaagtgctcttggataagtttataataagaagaaagtttattcctgacccccagggcaca
aatttgatgtttgccttctttgcccagcacttcacccatcagttcttcaagacagatcat
aagcgaggaccagctttcactaaaggactgggccatggggtggatttaaatcatgtttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatgggaaaatgaaatac
cagctaattgatggagaggtgtatccccccacagtcagggacactcaggtggagatgatc
tacccgcctcacgtccctgagcacctgcggtttgctgtgggccaggaggtgttcggcctg
gtgcctggtctcatgatgtacgccacgatctggctgcgagaacacaacagagtgtgcgac
gtgcttaagcaggagcacccagagtgggatgatgagcggctcttccagaccagcaggcta
atcctgataggagaaactattaagattgtgatcgaagactatgtacagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgcattgctgctgagtttaataccctctaccactggcatccccttctgccggacacc
ttccacatcgatgaccaggagtacagctatccgcagttcgtctacaacaactctttactg
atggaacacgggcttacccagtttgtggaatcattcagcaagcagattgctggcagggtt
gctggcggtcggaaccttccagctgccgtccgatacgtagcaaaggcctcaatcaaccac
agcaggcacatgaaataccagtcccttaatgagtaccgaaaacgctttcggatgaagccc
tatgagtcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcactc
tatggtgacattgacgccatggagctgtaccctgcccttctggtggaaaagcctcgcccc
gatgccatctttggtgagaccatggtagaactcggagctcctttctctttgaaaggactg
atgggcaaccccatatgttctcctcactactggaagcccagcacttttggtggagaagtg
ggttttaaaatcatcaacactgcctccattcagtctctcatctgcaataacgtgaaaggc
tgcccctccacctcgttcagtgttcagaacccggcccccgccaagacagtcaccatgagt
gccagcccctcccactccagactggacgatatcagcccgaccgtgctcctgaagggacgc
tcagctgaactgtag

DBGET integrated database retrieval system