KEGG   Miniopterus natalensis: 107546251
Entry
107546251         CDS       T05883                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107546251 (CACNA1E)
   04020 Calcium signaling pathway
    107546251 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107546251 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107546251 (CACNA1E)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107546251 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 107546251
NCBI-ProteinID: XP_016080077
LinkDB
Position
Unknown
AA seq 2032 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGQGAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSSHRPPCPGTVLRRATIKR
SRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISVRHMVKSQV
FYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFH
SSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLM
SSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGE
DWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQ
EEEEAFNQKHALQKAKEVSPMSAPNMPSIERERRRRHHMSVWEQRTSQLRRHMQMSSQEA
LNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRSRPIEGLALGLGLEKCEEERISRGGSL
KGDGGDLSSALDNQRSPLSLGKREPPWLARPCLGNCDPAQQEAGGGETVVTFEDRARHRQ
SQRRSRHRRVRTEGKEPSSASQSRSASQERGLDDGVPTEGEKDREPRGSHASREPTIQEE
EGAQDLRRTNSLMVPRGSGLAGALDEADIPLVLPEAELEVGKALTEQEPEGSSEQALLGD
VQLDVGRVISQSEPDLSCVTANTDKAATESTSVTVAIPDVGPLVDSTVVHISSKTDGEAS
PLKEAETKEEEEEEGKKPKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCI
LLVIAASSIALAAEDPVLTNSERNRVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFR
DLWNILDFVVVVGALVAFALATNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVV
TSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEV
KGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFY
VVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQN
RHTFQYRVWHFVVSPSFEYTIMAMIALNTIVLMMKYYSAPCTYELALKYLNIAFTMVFSL
ECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARL
IKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRH
NNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQSESERCGTDLAYVYF
VSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIPYKD
MYKLVRVISPPLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAK
GGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKV
KKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVPGLSGRSGYPSMSPLSP
QEIFQLACMDPPDDAQYQEQQSLVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENT
YKSRRRSYHSSLRLSAHRLNSDSGKEVFFLFAFRVPALMGVFWQGLNTSGRD
NT seq 6099 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccagggtctggcgatggagactcggac
cagagcaggaaccggcaaggaacccccgtgccagcctcggggcagggggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcctgtccggcag
aactgtttcaccgtcaacagatccctgttcatctttggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcctggccaccatcatt
gccaactgcatcgtcttggccctggagcagcatcttcccgaggatgacaagacccccatg
tcccgcagactggagaagacggaaccgtatttcattgggatcttttgctttgaagctggg
atcaaaatcgtggccctggggttcatcttccacaagggctcgtacctccgcaatggctgg
aatgtcatggacttcatcgtggttctcagcggcatcctggccactgcgggaacccacttc
aacacgcatgtggacctgaggaccctccgggccgtgcgtgtcctgaggcccctgaagctc
gtgtcggggatacccagcctgcagatcgtgctgaagtccatcatgaaggccatggtgccc
ctgctgcagatcggcctcctgctcttcttcgccatcctgatgttcgctatcattggcttg
gagttctacagtgggaagctgcaccgcgcctgcttcatgaacaattcaggtattcttgaa
ggattcgacccccctcacccatgtggcgtgcagggctgcccagctggttatgaatgcagg
gactggatcggccccaacgacgggatcacccagtttgacaacatcctctttgctgtgttg
actgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttctggggaatttgccaaggagagggagaga
gtggagaaccggagggccttcatgaaactgcggcgccagcagcagattgagcgggagctg
aatgggtaccgcgcctggatcgacaaagcagaggaagtcatgcttgctgaggaaaataaa
aactcttctcaccgccccccgtgtcctggcacagtgcttcgacgggccaccatcaaacgc
agccgcacagaggccatgacccgagactccagcgacgagcactgtgttgacatctcctct
gtgggcacgcccctggcccgagccagcatcaaaagcgcaaaggtggacggggcctcctat
ttccggcacaaggagaggctcctgcgcatctctgtccgccacatggttaaatcccaagtg
ttttactggatcgtgctgagcctggtggctctcaacaccgcctgtgtggccatcgtccat
cacaaccagccccagtggctcacccacctcctctactatgcagaatttttgtttctggga
ctcttcctcttggagatgtccctgaagatgtatggcatggggcctcgcctttattttcac
tcttcattcaactgctttgactttggggtcacagtgggcagtatctttgaagtagtctgg
gcaatcttcagacctgggacatcttttggaatcagtgtcttgcgagctctccggcttcta
agaatatttaaaataaccaagtactgggcatccctacggaatttggtggtctccttgatg
agttccatgaagtctatcatcagtttgctcttcctactcttcctcttcatcgttgtcttt
gctctcttaggaatgcagctgtttggaggcaggtttaactttaatgatgggactccttcg
gcaaactttgacacctttcctgcagccatcatgactgtgttccagatcctgacaggtgag
gactggaatgaggtgatgtacaatgggatccgctcccagggtggggtcagctcgggcatg
tggtcagctatctatttcattgtgctcaccttgtttggaaactacacgctgctgaatgtg
ttcttggccatcgctgtggacaatctggccaatgcccaggagctgaccaaggatgagcag
gaagaagaggaggccttcaaccagaagcatgcactccagaaggccaaggaggtcagcccg
atgtccgcgcccaacatgccttctatcgagagggagcggaggcgccgccaccacatgtca
gtgtgggagcagcgcaccagccagctgaggcggcacatgcagatgtccagccaggaggcc
ctcaacaaggaggaggccccgcccatgaacccgctcaaccccctcaacccgctgagcccc
ctcaacccgctcaatgcccaccccagcctctaccggagatcccggcccattgaggggctg
gccctgggcctgggcctggagaagtgtgaggaggagcgcatcagccgcggggggtccctc
aagggggacggaggggacctctcgagtgccctggacaaccagaggagccccttgtccttg
ggcaaacgggagccgccgtggctggccaggccctgtcttgggaactgtgacccggcccag
caggaggctgggggaggcgagactgtggtgacctttgaggacagggccaggcacaggcag
agccagcggcgcagccggcaccgccgagtcaggacggagggcaaggagccttcctccgcc
tcccagagccggtcggccagccaggagcgaggcctggatgacggtgtgcccaccgagggg
gagaaggaccgcgagcccaggggcagccacgcgagcagggaacccacgatccaggaagaa
gagggagcccaggacttgaggaggaccaatagtctgatggttccccgaggctccgggctg
gcaggagcccttgacgaggctgacatacccctcgtcctgcccgaagcagagctggaagtg
gggaaggcgctgacggagcaggagcccgagggcagcagtgagcaagcgctgctgggggac
gtgcagctggacgtgggccgggtcatcagccagagtgagcccgacctctcctgcgttact
gccaacacggacaaggccgccaccgagagcaccagcgtcactgtcgccatccctgacgtg
ggccccctggtggactcgaccgtggtgcacatcagcagcaagactgatggtgaagccagt
cccttgaaggaggcggagaccaaagaggaggaggaagaggaggggaagaagccaaaggag
aagcgggagacgggcaaagccatggtgccccacagctccatgtttatcttcagcaccacc
aacccgatccgcagggcctgccactacatcgtgaacctgcgctacttcgagatgtgcatt
ctcctggtgatcgcagccagcagcattgccctggcggccgaggaccccgtcctgaccaac
tcggagcgcaacagagtcctgcggtattttgactatgttttcactggcgtgttcaccttt
gagatggttataaagatgatagaccagggcttgattctacaggatggttcctacttccga
gacctgtggaacatcctggactttgtggtggtagttggtgcgttggtggcctttgctttg
gcaaccaacaaggggcgggacatcaagaccatcaagtctctgcgggtgctccgggttctg
aggccactgaagaccatcaaacgcctgcccaagctcaaggctgtctttgactgtgtggtg
acctcactgaagaacgtcttcaacatactcattgtctacaagctcttcatgttcatcttt
gctgttatcgctgttcagctgttcaagggaaagttcttttattgcacggacagttccaag
gacacagagaaggagtgcataggcaactatgtggatcatgagaaaaacaagatggaagtg
aagggtcgggaatggaagcgccatgaattccactacgacaacatcatctgggcccttctc
acgctcttcaccgtctccacgggggaaggatggcctcaggttttgcagcactctgtggat
gtgacagaggaggaccggggcccgagccgcagcaaccgcatggagatgtccatcttttat
gtggtctacttcgtagtcttccccttcttctttgtcaacatctttgtggctctcatcatc
atcactttccaggagcagggggacaagatgatggaggagtgcagcctggagaagaacgag
agggcctgtatcgactttgccatcagtgccaagccgctcacccgctacatgccacagaac
aggcacaccttccagtatcgcgtctggcacttcgtggtgtccccgtcctttgagtacacc
atcatggccatgatcgccttgaacaccatcgtgctgatgatgaagtactactctgctccg
tgtacttatgaactggccctgaagtacctgaatattgccttcaccatggtgttttccttg
gaatgtgtcctgaagatcatcgcatttggcttcttgaactatttccgagacacctggaat
atcttcgacttcatcaccgtgatcggcagcatcacagaaatcatcttgacagacagcaag
cttgtgaacaccagtggcttcaacatgagcttcctgaagctcttccgcgccgcccgcctc
atcaagctgctgcgtcagggctacaccatccgtattctgctctggaccttcgttcagtcc
tttaaggccctcccctacgtctgccttttgattgccatgcttttcttcatctatgccatc
attgggatgcaggtatttggaaacataaaactagatgaggagagtcacatcaaccggcac
aacaacttccggagtttctttgggtccctcatgctactgttcaggagcgccacgggggag
gcctggcaggagatcatgctgtcgtgcctcggggagaaaggctgtgagccggacaccacg
gcgccgtcggggcagagcgagagcgagcgctgcggcaccgacctggcctacgtgtacttt
gtctccttcatcttcttctgctccttcctgatgctcaacctgttcgtggctgtcatcatg
gacaactttgaatacctgactcgggactcatccatcctggggcctcaccacttggacgaa
tttgtccgtgtctgggcagaatatgacagagctgcatgtggcaggatcccgtataaggat
atgtacaaattagtgcgggtcatctcgccgcctttgggcctgggagagaactgcccctac
agggtggcttgcaagaggttggtcctgatgaatatgcccgtggccgaggacatgactgtc
cacttcacctccaccctgatggctctgatccggacagctctggacatcaagatcgccaaa
ggtggtgctgacaggcagcagctagactcggagctacagaaagagaccctggccatctgg
cctcacctttcccagaagatgctagacctgcttgtgcccatgcccaaagcctctgacctg
actgtgggcaaaatctatgcagcaatgatgatcatggactactacaaacagagtaaggtg
aagaagcagaggcagcagctggaggaacagaaaaacgcacccatgttccagcgcatggag
ccctcgtctctgccgcaggagatcatcgccaacgccaaagctctgccttacctccagcag
gaccccgtgccaggcctgagtggccggagtggatacccttcgatgagtccgctctccccc
caggaaatattccagctggcgtgcatggacccacccgatgacgcacagtaccaagagcag
cagtctctggtggtaacagacccgagctccatgagacgttcattttccacgattcgggat
aagcgttccaattcctcgtggttggaggaattctccatggagcgaagcagtgagaacacc
tacaagtcccgtcgccggagttaccactcctccctgcggctgtcagcccaccgcctgaac
tcagactcaggtaaggaggtctttttcctgtttgcctttcgggttcctgccctgatgggg
gtattctggcaaggactgaacacctctggaagagactga

DBGET integrated database retrieval system