KEGG   Miniopterus natalensis: 107546254
Entry
107546254         CDS       T05883                                 

Gene name
LRP2
Definition
(RefSeq) low-density lipoprotein receptor-related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
mna  Miniopterus natalensis
Pathway
mna04340  Hedgehog signaling pathway
mna04918  Thyroid hormone synthesis
mna04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107546254 (LRP2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    107546254 (LRP2)
  09154 Digestive system
   04979 Cholesterol metabolism
    107546254 (LRP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107546254 (LRP2)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    107546254 (LRP2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 cEGF SGL EGF_CA
Other DBs
NCBI-GeneID: 107546254
NCBI-ProteinID: XP_016080115
LinkDB
Position
Unknown
AA seq 4694 aa
MRTAGNSRAQVGGALGRKGGIKWQLLPVGRTVSVAHFSVDSLADFRAEENLAERLVPSHC
DGESFRCADGRCIPASWRCDGTKDCFDDSDEIGCPPASCRPGYFQCHNKEQCIPNSWVCD
HEQDCEDGSDEHQHCPGTTCSSHQMTCSSGECIPVEYRCDHVRDCSDGTDEKDCRYPTCE
QLTCANGACYNISQRCDHKVDCRDFSDEDNCTEVCSRHQFQCGSGECLSHDYVCDHIPDC
EDGSDEHSCNYATCRGNQFTCPNGHCINQNWVCDGEDDCTDNGDEDGCESSPHHFHQCYP
GEWACPKSGKCIPITKVCDGTFDCPSGEDEGNATVQRHCDVTLCPLLGCEYQCHIAPYGG
ACYCPPGYVVDQNNTRKCVDFDDCHVWGVCDQMCEDRIGHHQCHCAEGYILEHERHCKAN
TSSGEASVIFSNGRDLLIGDIHGRSFQVLVESQNRGVAVGVDFHYHLQRVFWTDTMLDKV
FSVNINGLDIQEILNVSIDDPENLAVDWINNKLYMVETKVNRIDMANLNGSHRVILITEN
LGHPRGIALDPTVGYLFFSDLESLSGGPTVERAFMDGSNRKDLVKTKLGFPAGITLDMIS
KRVYWVDSRFDYIETVTYDGTQRKTVLHGGSLIPHPFGISLFEDSVFFTDWTKMAVMKAN
KFTETNPQVYYQSSLRPFGVTVYHSLRQPSASNPCGDNNGGCEQVCVLSHRTDNGGLGYR
CKCTFGFNLDADGHRCAAVKQFLIFSSEVAVRGIPFNISTQEDVMIPVTGNPSFFVGIDF
DAQEKTLFFSDTSVDMIYKQKMDGTGKEILIANRVESVESLTFDWISKNLYWTDLSYRSV
SVMRLADKSRREIVQNLNNPRAIVVHPIAGYIFFTDWFRPAKIMRAWGDGSNLLPIVNTT
LGWPNGLAIDWGALRLYWVDALFDKIEHSTFDGLDRRVLGHIQQMTHPFGLTVFQDYVFF
TDWRLGAIVRVRKTDGGDMTVIRSGISNIMHVKSYDDNIQIGSNYCNRPTHPNGDCSHFC
FPVPNFQRVCGCPYGMSLTSNHLTCMEDPAHEPPLEQCGSFSFPCTNGRCVPSYYRCDGI
DDCHDNSDEHLCGTFNNSCAPSAFTCGHGGECIPAQWRCDRHNDCVDGSDEQNCPTRPHI
SCPASFFTCDNNLCISRNWLCDTDNDCGDGSDEKDCNFTATCQPSQFHCPDHRCIDLFYV
CDGDKDCVDGSDENGCVINCTASQFKCASEDKCISNTYHCDGVFDCSDHSDEKDCPTRPP
GMCHPDEFQCQSDGLCIPGNWECDGHPDCIHGSDEHNGCVLKTCSPSHFHCDNGNCIYRE
WVCDGDNDCRDMSDEKDCPTQAFYCPSWQWQCPGHSICVNLSAVCDGISDCPNGTDESPL
CNQESCSNLNAGCTHQCVQGPFGAQCICPEGYLLANDSKTCEDIDECDIPGFCSQHCYNT
RGSFRCWCDKEYMLDTDGKTCKVTASESLLLLVASQNQIVADNITSQIHNIYALIEDGSH
IVAVDFDSVSGRVFWSDGTEGKIWSAFQNGTDRKVVLDSGVTMTESLVVDWVGRNLYWTD
YVLQTIEVSKLDGSHRTVLIGQNVTMPRGLAIDPRVSDHLMFWSDWGHHPRIERASMDGS
LRTIIVQDKILWPNGLTIDYPNRLLYFLDAYLDYLDFCDYDGQHRRQVIASDLILRHPYA
LTLFEDSVYWTDRATQQVTQANKWHGGNQSVVIYNVHQPLGIVAVHPSKQPNGINSCAFA
RCSHLCLLSSQRPQLYSCACPSGWSLSHDSLTCLRDDEPFLITVRRSVIFGISLHPEVKS
NDAMVPVSGIQNGYDVEFDDSEEFIYWVENPGEIHRVKTDGTNRTVFVPLSSLGSSMSLA
LDWISRNLYYTNPGTQSIEVLTLQGDVRYRKTLITNDGTALGVGFPVGITVDPANGKLYW
SDQGTDSGVPAKIASAHMDGTSPKTLFTGDLEHLEFLTLDIEEQKLYWAVTSRGVIERGN
VDGTNRMVLVNYLSHPWGIAVYGPFLYYTDEHYEVIERVDKATGANKVVLRDNTPNLRGL
RVYHRHNSAGSSNGCSNNVHACQQICLPVPGGLFSCACATGFKLNPDSQTCSPYNSFIVV
SMLSAIRGFSLELSDHSEAMVPVAGQGRNALHVDVDVSSGFIYWCDFSISEKSYNAIRRV
KPDGSGFTNIITHGIGENGVRGIAMDWVAENLYFINAFDSEALIEVLRINTTYRRVLLRV
IVDMPRDIVVDPKNRYLFWADYGQNPKIERAFLDCTNRTVLVSEGIVSPRGLAVDHSNGY
VYWVDDTLDVISRINAEGKELKVIRYGSRYPTPYAITVFGNSIIWVDRNLKKIFQASKEP
GNTEPPAVIRDNINWLRDVTVFDRSVQPRSASEVNNNPCLENNGGCPHLCFALPGLHTPN
CSCVFGTLDRDGKSCTIPKENFLIFALENSLGSLHLDPEDHTLPFQAISVGGHVMALDYD
SINNRIYFTQNLEARHGQISYVNLNAGISSPTVIVSDIGTTDGIAFDWINRRVYYSDFTN
QTINSMAEDGSKRAVIAHVPKPRAIVLDPCGGYIYWSSWDTNAKIERATMGGNFREPIVN
SSLVWPCGLTVDHEEDLLYWTDTSLRKIERSTLKGMDREVIVSTILRPFGLTLNGQYIYW
TDWSTKKIYRANKYDGSGQTAMTTSFPVRLMGVCVVVKDHPQQCSNPCDQFNGGCSHICA
PGPNGAECQCPQEGHWYLANNNKHCIVDSGVRCVGSNFTCLNGRCILEQWKCDNSNDCGD
GSDELENVCAFHTCHSTAFTCDNGRCVPYHYRCDHYNDCGDNSDEEGCLFSACNATTEFT
CSNRRCIPLQFVCNGVNNCHDNDTSDEKNCPDHTCQSGFTKCHSTNICIPRTYLCDGDND
CGDMSDESPTFCAVHTCSNNEFHCTSGRCIPSRWYCDQERDCPDGSDEPATCGYHESTCL
SDEFKCDNGRCIEAEWICDNDNDCGDMSDEDERHHCESHKCSASQFLCVNNVPPSSRCIP
QSWVCDGDEDCTDGFDERQNCTRGSCSGNDFTCSDGRCVPDSYRCDRHNDCGDYSDERDC
SYPTCDQNQFTCQNGFCIYKAYICDGDNDCGDDSDELEHLCHVPETTCPPHQFKCDNGNC
IEMVKVCNHLDDCLDNSDEKGCGINECNDPSLSGCDQNCTDTLTSFYCSCRPGYKLMSDK
RTCSDIDECQETPFVCSQKCENIVGSYICKCAPGYIREPDGRSCRQNSNIEPYLIFSNRY
YLRNLTIDGSFYSLILQGLGNAVALDFDRVEKRLYWIDIEKKVIERMFLNKTNRETIMKH
KLPAAESLAVDWVARKLYWVDAHLKCLSVSDLDGRYRRRLVEHCLDANNTFCFDNPRGIV
LHPQYGYVYWADWTHRAYIGRVGMDGINKSVIISTKIEWPNGITIDYTNDRLYWADAHLG
YIEYSDLEGHHRHTVYDGILSHPFAITIFEDTIYWTDWNTRTVEKGNKYDGSDRMMLVNT
THKPYDIHVYHPYRQPIVNNPCGINNGGCSHLCLIEAGGKGFTCECPDDFKTIHLADSTH
CLPMCSSTQFLCANNEKCIPIWWKCDGQKDCLDGSDESPICPPRYCRLGQFQCKDGNCTS
PHFLCDTHQNCPDGSDEDLILCENHKCESNEWQCANKRCIPEAWQCDSLNDCGDNSDEDS
SHCASRICQPGYFKCANGHCIPQTWKCDVDNDCGDYSDEPIQECMGPAYRCDNHTEFSCK
TNYRCIPKWAVCNGADDCRDNSDEQGCEEMTCKPVGVFRCNNHQCIPLRWKCDGHDDCGD
HSDEENCVPRECTESEFRCDDQRCIPSRWLCDFNNDCGDNSDERDCEMRTCHPGYFQCKS
GHCVPDDLKCDGMIDCLDASDEAVCPTRFPNGTYCPAVMFECKNHVCIQSYWICDGDNDC
GDGSDEELHLCLSVPCESPHRFRCDNNRCVYSHELCNHKDDCGDGSDEKVENCVGPTPRP
CAEDEFKCSNKQCISQHLACDDVDDCGDQSDETGCNVGKERSCAENLCEQNCTQLSEGGF
ICSCRSGFKASISDRNSCDDINECEQFATCPQHCQNTKGSYECYCAEGFRSLSGIHGDRC
EADGNPPLLLLPENVRIRKYNLSSEKYADYLEEQERIQAVDYDWDPEGIGLSVIYYTVLG
YGSNFGAIKRAYIPNFESGSNNHVQVINLGLKYIMQPDGLAVDWVGRHIYWSDARSQRIE
VAKLDGRYRKWLITTQLDQPAAVVVNPKLGLMYWTDWGKEPKIESAWMDGQHRNILVRED
LGWPTGLSIDYLNNDRIYWSDFKEKTIETIRYDGTDRRIVASAAVDPYSLDIFEGRLYWV
AKDKGEVWTQDKFGHEEKERRLTVSPWLTQVRVLHQHRYNQSVPNRCKNVCSHLCLLRPE
GYSCACPQGSTFLEGSMTECNAAVENAMVMPPPCRCMHGGNCYFDENDLPKCKCPSGYMG
NYCEIGLSKGIPPGTTMAVLLTVILIIIIGALATLGFFHYRKTGSLLPSLPKLPSLSSLV
KSSDTGNGVTFRSGADVNMDIGVAGFGPESAIDRAMVMSDHFTMEMGKQPIVFENPMYAT
RDSAVKEAQQSQGPLIFTQVTASENVDNKNYESPVNPAEVAPDTKSASASADGTQATKWN
IFKRKLKQTTNFENPIYAEMEGEQKESAAGAPPLPPSPSPPTKAQTKRTPAPAYSATEDT
FKDTATLVKEDSEI
NT seq 14085 nt   +upstreamnt  +downstreamnt
atgcgcactgccgggaacagcagggcccaggtgggcggtgccctggggagaaagggtggc
attaagtggcagctcttgcccgtggggaggaccgtgtcggtggcacatttttcggtggac
agcttagccgacttccgtgcggaggaaaatcttgcggagcggctcgtgccctcgcactgt
gacggcgagagttttcgctgtgcggacggccgctgcattcctgcctcctggaggtgcgac
gggaccaaggactgtttcgatgactctgatgagattggctgccctcccgcttcttgccgg
ccgggctatttccagtgtcacaataaagagcaatgcatccctaactcctgggtgtgtgac
catgagcaggactgtgaggatggctcagatgaacatcagcattgccctgggacaacatgc
tcaagccatcagatgacatgctccagtggtgaatgtatcccagtcgaatacaggtgcgac
cacgtcagagactgctcagatggaactgacgagaaagactgccgatacccaacatgtgag
cagcttacttgtgccaacggagcctgctataacattagtcagagatgtgatcataaagtt
gactgcagggacttctccgatgaagacaactgcactgaagtatgttcccgccaccagttt
cagtgtggcagcggcgagtgcctctctcatgactacgtctgtgaccatatcccagactgt
gaagatggcagtgatgaacattcttgcaactacgcgacctgcagaggcaatcagttcacg
tgccccaatggccactgcattaatcaaaactgggtctgtgatggagaagatgactgcaca
gataatggagatgaagatggatgtgaaagcagccctcatcattttcatcaatgctaccca
ggtgaatgggcttgtccaaagtctggaaaatgcatcccaattacaaaagtctgtgatgga
actttcgattgtccatcaggagaagatgaaggcaatgccactgtacaacgacattgtgat
gtgactttgtgtcctttattgggctgtgagtatcaatgccacattgcaccatatggaggg
gcgtgttattgtcctccaggttatgtcgtcgaccaaaataacacccgtaaatgtgtcgat
tttgacgattgccacgtatggggagtttgtgaccagatgtgcgaagatcgaattggccat
caccagtgccactgtgcagaagggtatatcttggagcatgagcggcattgcaaagctaat
acttcctctggtgaggcctctgttatcttctccaatggtcgagatttgctaattggtgat
atacatggaagatcctttcaggttctggtagagtctcaaaatcgtggagtggctgtgggt
gtggattttcactatcacctacaaagagtcttttggactgacaccatgctagataaggtt
ttttcagttaatattaatggtttagatatccaagaaattctcaatgtttctattgatgat
ccagagaatctggctgtggactggattaataataaactttatatggtggagaccaaggtc
aaccgcatagatatggccaatttgaatggaagccaccgagttattcttattactgaaaac
ttggggcatcctagaggaattgcccttgacccaactgtgggttatttatttttctcagat
ttggagagcctttctggggggcctacagtggaaagggctttcatggatggcagtaaccgt
aaagatttagtaaaaacaaagctgggattccctgctgggataactctggacatgatatca
aagcgtgtttactgggttgattcccggtttgattacattgagactgtaacttacgatgga
actcaaaggaagaccgtgcttcatgggggctcactcattccccatccctttggaataagc
ttgtttgaagatagtgtgttctttacggactggacaaagatggctgtgatgaaggcaaac
aagttcacagagaccaacccacaagtgtactaccagtcttccttgaggccctttggagtg
actgtttaccactccctcaggcagcccagtgctagcaatccctgcggagataacaatggg
ggctgtgagcaggtctgcgtcctcagtcacagaaccgacaacggcggcctgggctaccgc
tgcaagtgcacctttggcttcaacctggatgcggatggccaccgctgcgctgctgttaag
caattcctgatcttttcatctgaagtggctgttcgtgggatcccatttaacatctctacc
caggaagatgtcatgattccagtgacaggaaacccttctttctttgttggaattgatttt
gatgcccaggagaaaactctctttttttcagacacatcagtagacatgatttataaacaa
aagatggatggcacaggaaaagaaattctcatagcgaacagggtggaaagtgttgaaagt
ttgacttttgactggatttcaaagaacctctattggacagacctttcctataggagcgtc
agtgtcatgaggctagctgataaatcacgacgtgagatagtccagaatttaaataaccca
cgagcaatcgtagttcatcctattgctgggtatatattctttactgattggttccgccct
gctaaaattatgagagcatggggtgatggatctaaccttttgcctatagtaaatactact
cttggatggcccaatggattggccattgattggggtgctttacgattgtactgggtagat
gccttatttgataaaattgagcacagcacctttgatggtttagatagaagagtcctgggc
catatacagcagatgacacatccatttggacttaccgtctttcaggattatgtatttttc
actgactggagactgggtgctattgttcgagtcaggaaaacagatggtggagacatgaca
gttatcagaagtggcatcagtaatataatgcatgtgaaatcatatgatgacaatatccag
attggttctaactattgtaaccgacccactcatccgaatggcgactgcagccacttctgc
ttcccagtgccaaattttcagcgggtgtgtggttgtccctatggaatgagcctgacttcc
aatcacttgacgtgcatggaagacccggcccatgaaccacccctggagcagtgtggctcc
ttttccttcccatgcaccaacggcagatgtgtgcccagctactaccgctgtgatggaatt
gatgactgtcatgataacagcgatgaacatctatgtggcacatttaataattcctgtgca
ccttcagcgttcacctgtggccatgggggagagtgcatccctgcacagtggcgctgtgac
aggcacaatgactgtgtggatggcagtgatgagcagaactgccccacccggccacacatt
tcctgccctgcatctttcttcacctgtgataataacctctgtatctcaaggaactggctc
tgtgacacagataatgattgtggggatggatctgatgaaaaggactgcaactttacagca
acctgccaacctagtcagtttcattgccctgaccatcggtgtattgacctgttttatgtc
tgtgatggggacaaggactgtgttgatggatctgatgagaacggttgtgtaattaattgc
actgcttctcaattcaaatgtgccagtgaggataagtgtattagcaacacatatcattgt
gatggtgtttttgactgcagtgaccactctgatgagaaagactgtccaaccaggcctcct
ggtatgtgccatccagatgaatttcagtgccaatcagatggtctctgcatcccggggaac
tgggagtgtgatgggcacccagactgcatccatggatctgatgagcacaatggctgtgtg
ctcaagacctgctctccatctcatttccattgtgacaatggaaactgcatctacagagag
tgggtctgcgacggggacaatgactgcagggatatgagtgatgagaaggactgccctact
caagccttttactgtcccagttggcaatggcaatgccctggccatagcatctgtgtgaat
ctgagtgcagtatgtgatggcatctctgactgccccaatgggacagatgagtccccactt
tgcaaccaggagagctgctcaaatttaaatgctggttgtactcaccagtgtgttcaaggg
ccctttggggctcagtgcatatgtccagagggatacctgcttgccaatgattctaagacc
tgtgaagacatagatgaatgtgacattccaggcttctgtagccagcattgttacaatacg
agaggttctttccggtgctggtgtgataaagaatacatgctagacactgatgggaagact
tgcaaagttacagcatctgaaagtcttctgttacttgtggcaagtcagaaccaaattgtt
gctgacaatattacctcccagatccacaatatctatgcacttatcgaggatggctctcac
attgtagctgttgattttgattccgtcagtggtcgtgtcttttggtctgatggaactgag
gggaaaatctggagtgcatttcaaaatggaacagacagaaaagtagtacttgacagtggt
gtcaccatgactgaaagtcttgtggtagattgggtgggtcgcaatctttactggacagac
tatgttctgcaaacaattgaagtctctaaactggacgggagccacaggactgtgctgatt
ggtcaaaatgtaacaatgccaaggggactagctatagatcccagagttagtgaccatctg
atgttctggtctgactggggccatcacccccgtatagagcgagccagcatggacggcagt
ttgcgcaccattattgttcaagacaagattctatggcccaatggcttaactattgactac
cccaacagactgctctacttcttggatgcctatcttgattacttagatttttgtgattat
gatggacaacatcggaggcaggtgatagccagtgatttgattctgcggcatccctatgcc
ctaactctctttgaggattccgtgtactggactgaccgcgcaactcaacaggttactcaa
gccaacaagtggcatggagggaaccagtcagttgtaatttataatgtgcaccagcccctt
ggcattgttgcagttcatccttcgaaacagccaaatggcataaattcatgtgcctttgcc
cgctgcagccatctatgcctgctttcctcacagaggccacagctttactcctgtgcttgt
ccctctggatggagcctctctcatgattctttgacttgcctgagagatgatgaacctttc
ttaataactgtaagacgcagtgtaatttttggaatctcccttcatcctgaggtgaagagc
aatgatgctatggttcccgtatcggggatacagaatggttatgatgttgaatttgatgac
tccgaggaattcatctattgggttgagaatccaggtgaaattcacagagtgaagacagat
ggcaccaacaggacagtgtttgttcctctgtctagtttgggctcttctatgagcctggcc
ttagactggatatcaagaaacctttattacaccaaccctggaactcagtcaattgaggtt
ttgacactccagggagatgtcagatacagaaaaacactgattaccaatgatgggacagct
cttggagttggttttccagttggcataaccgttgatcctgctaatgggaaactctactgg
tcagaccaaggaactgacagtggagttcctgctaagattgcaagtgctcacatggatggc
acatctccaaagacccttttcactggagaccttgaacacttggagtttctcactcttgat
atagaggaacagaagctctactgggccgtcaccagcaggggagtgattgaaagaggaaac
gtggatggtaccaatcgaatggttctggtaaactacctttctcacccttggggaattgct
gtctacggtcccttcctttattacactgatgagcattacgaggtcattgaaagagttgac
aaggctactggggccaacaaagtagtcttgcgagataacactccaaatctgaggggactt
cgagtttaccatagacacaactctgccggatcctcaaatggctgtagcaacaacgtgcat
gcctgtcagcagatctgcttgcctgtaccaggaggactgttctcgtgtgcctgtgccact
ggatttaaactcaatcctgatagccagacctgctctccctacaactctttcattgttgtt
tcaatgctgtctgcaataagaggctttagcttggaactgtcagatcattcagaagccatg
gtaccagtggcaggccaaggacgaaatgcactgcatgtggatgttgatgtgtcttctgga
tttatttattggtgtgatttcagcatctcagagaaatcttataatgcaatccgtagagtc
aaacccgatggatctggtttcacaaacatcattacccatgggataggtgaaaatggagtg
cggggtattgccatggactgggtagcagaaaacctttatttcatcaatgcttttgactct
gaagccctgatagaagttctgcgcatcaataccacctaccgtcgggttctccttagagtc
atagtggatatgcccagggatattgttgtagaccccaagaatagatacctcttctgggct
gactatgggcaaaacccaaagattgaacgtgcttttcttgactgcaccaatcggactgtg
cttgtatcagaaggcattgtctcaccacggggcttagcagtggaccatagcaatggctac
gtttattgggttgatgatactttagatgtaatttcaaggatcaatgctgagggaaaggaa
ttgaaagtgattcgttatggcagtcgttacccaactccttatgccatcactgtttttgga
aattctatcatatgggtagacagaaatttaaaaaaaatcttccaagctagcaaggaacca
gggaacacagagccaccagccgtgataagggacaatatcaattggctaagagatgtgaca
gtctttgaccggagtgtccagccccggtcagcatcagaggtcaacaacaacccttgcttg
gaaaataatggtggatgcccccatctctgctttgctctacctggattgcacaccccaaac
tgtagctgtgtttttgggaccctggaccgtgatggcaagagttgtaccattccaaaagaa
aatttcctcatctttgccttagagaattccttgggaagcttacacttagatcctgaagac
cataccctacctttccaagcaataagtgtgggaggacatgtcatggccctggactatgac
agcataaataacagaatttacttcacacaaaatttagaagctagacatggccagatttcc
tatgtcaacctgaatgcagggatcagttctcccactgtcattgtttcagatatagggact
actgatggcattgcttttgactggatcaatagaagagtttattacagtgactttaccaac
cagacgattaactccatggctgaggatggatctaagcgtgctgtgatagcccatgttcca
aagccaagagcaattgtgttagatccttgtggagggtacatctactggagttcctgggat
actaatgccaaaattgagagagccacaatgggaggaaacttccgggaacccattgtgaac
agcagcctggtctggccctgtgggctcactgtggaccatgaggaagatcttctctactgg
acagatactagtttgcgcaagattgaacgcagcactctaaagggcatggaccgtgaggtc
attgtcagcacaatcttgcgtccttttggcttgactctcaatggccagtatatttactgg
actgactggtccacaaaaaaaatttaccgagctaacaaatatgatggatcaggccagact
gcaatgaccacgagttttccagtccggcttatgggtgtttgtgttgttgtgaaggaccac
ccacagcagtgcagcaatccttgcgaccagtttaacgggggctgcagccatatttgtgca
ccaggtccaaatggtgccgagtgccagtgtccacaggagggccactggtatctggccaac
aacaataagcattgcattgtggacagtggtgtacggtgtgttggttccaatttcacctgc
ctcaatgggcgctgcatcttggagcagtggaaatgtgacaacagcaatgactgtggtgat
ggcagtgatgagctggaaaatgtgtgtgcatttcacacctgccattcgacagccttcacc
tgtgacaatgggcgatgtgtcccgtatcattatcgctgtgatcactacaatgactgtggt
gacaacagtgatgaggaagggtgcctgttcagtgcgtgtaatgccaccacggaatttacg
tgcagtaacaggaggtgcatacctctccagtttgtctgcaacggcgtaaacaactgccac
gataatgacacttcagacgagaaaaattgccctgatcacacttgccagtctggattcaca
aagtgtcacagtacaaatatttgtattcctcgtacttacctgtgtgatggagacaatgac
tgtggagatatgagtgacgaaagccccactttttgcgccgttcacacatgcagcaacaat
gagttccactgcacatctggacgctgtattcctagccgttggtattgtgatcaagaaaga
gattgtcctgatggctctgatgaacctgccacttgtgggtaccatgagtcaacatgtttg
agtgatgagttcaagtgtgacaatgggaggtgcatcgaagcagaatggatctgtgataat
gataatgactgtggggacatgagcgatgaagatgaaagacaccactgtgagagtcacaaa
tgctcagcttctcagtttctctgtgtaaacaatgtgcctccatccagtaggtgcattccc
cagtcttgggtctgtgatggcgatgaagactgtactgatggcttcgatgagcgacagaac
tgcacccggggatcttgctctggaaacgatttcacctgtagtgatggacggtgtgtccca
gactcctacaggtgtgatcggcacaatgactgtggtgactacagtgatgagagggactgc
tcataccctacctgtgatcagaatcagtttacctgtcagaatggcttctgcatttataaa
gcctacatctgtgatggggataatgactgtggagatgattccgatgagctggagcacttg
tgccatgtccccgaaaccacgtgcccccctcatcagttcaagtgtgataatgggaactgc
atcgaaatggtgaaagtctgcaaccacctagacgactgtttagacaacagtgatgagaaa
ggatgtggcattaacgagtgcaatgacccttcactcagtggctgcgaccagaactgcaca
gacacgttaaccagtttctattgttcttgccgtcctggttacaagcttatgtcggacaag
cggacttgtagtgatattgacgaatgccaggagacaccctttgtctgtagccagaagtgt
gagaacatagtgggctcttacatctgtaagtgtgccccaggctacatccgagaaccagat
ggaaggagctgccggcagaacagtaacatcgagccctatctcatttttagcaaccgttac
tatttgagaaacctaactatagatggctccttttactccctcattttgcaaggactggga
aatgctgtggcactggattttgaccgagtagaaaagagattatactggattgatatagag
aaaaaagtcatcgagagaatgtttctaaataagacaaacagggagacaatcatgaagcac
aaactaccagctgcagaaagcctggctgtagactgggttgccagaaagctttattgggtg
gatgctcacctgaagtgcctctctgtctctgaccttgatggtcgataccgccgcaggctg
gtcgagcactgtttggatgccaacaacaccttctgctttgataatcccagaggaattgtc
cttcaccctcaatatgggtatgtctactgggcagactggacccacagagcatacattggg
agagtaggcatggatggaatcaataaatctgtgattatctctaccaagatagagtggccc
aatggcatcaccattgattacaccaatgatcgactctactgggcagatgctcacctggga
tacatcgagtactctgatttggagggccaccatcgacacacagtgtatgatgggatactg
tctcacccttttgctattactatttttgaagacactatttattggacagattggaataca
aggacggttgaaaagggaaacaaatatgatggatcagatagaatgatgctggtgaacaca
acacataaaccgtatgacatccatgtgtatcatccatataggcagccaattgtgaataat
ccctgtggtatcaacaatggtggttgttctcatctctgcctcatagaagcaggagggaaa
ggattcacctgcgagtgtccagatgacttcaagaccatccatctggctgacagcacccac
tgcttgcccatgtgctctagcacccaatttctgtgcgctaacaatgaaaagtgtattcct
atctggtggaaatgtgatggacagaaagactgcttggatgggtccgatgaatcccccatt
tgcccgccacgctactgccggctaggacagttccagtgcaaggatggcaactgcaccagc
ccacacttcctatgtgacactcaccagaattgccctgatgggtctgatgaagacctcatt
ctttgcgagaaccacaaatgtgagtccaatgaatggcagtgtgccaacaaacgttgcatc
ccagaagcctggcagtgtgactcgttaaatgactgcggggataattcagatgaagacagt
tcccactgtgccagcaggatctgccagcccggctattttaaatgtgccaatggccactgc
atccctcagacctggaagtgtgatgtagacaatgactgtggcgactactcggatgagccc
atccaggaatgcatgggccctgcctatcgctgtgacaaccatacggaattcagctgtaaa
acaaactaccgctgtatcccaaagtgggccgtgtgcaatggcgccgatgactgcagggac
aacagcgacgagcagggctgcgaggagatgacctgcaaacctgtgggggttttccgctgt
aataatcaccaatgcatccctcttcgctggaaatgtgatgggcacgatgactgtggagat
cactcagatgaggaaaactgtgtccctcgggagtgcacagaaagcgagtttcggtgtgat
gatcagagatgcattccctctcgatggttatgtgactttaacaatgactgtggagacaac
tcggatgagcgggactgtgagatgcggacctgccatcctggatattttcagtgtaagagt
ggacactgtgtgcctgatgacttgaaatgtgatggaatgatcgactgtttggatgcctct
gatgaagccgtttgtcccactcgctttcccaatggtacatactgcccagctgttatgttt
gaatgtaaaaatcatgtctgtatccagtcatattggatatgtgatggtgacaacgactgt
ggcgatggttctgatgaagaacttcatctgtgcttgagtgttccctgtgagtcaccacac
cgtttccggtgtgacaacaatcgctgtgtttacagtcacgagttgtgcaaccataaggat
gactgtggagatggaagtgatgagaaagtggaaaactgtgtaggcccgacccctagacct
tgtgcagaggatgaatttaagtgcagcaacaagcaatgcatttcacagcacctggcatgc
gatgatgtcgacgactgtggtgaccagtctgacgaaacgggttgcaatgtaggaaaagaa
agatcatgtgctgaaaatctatgtgaacaaaactgtacccaattaagtgaaggaggattt
atctgctcctgcagatctgggttcaaagccagtatttctgatagaaactcctgcgacgac
atcaatgagtgtgagcaatttgcgacgtgtccgcagcactgccagaatactaaaggaagt
tatgagtgttactgtgccgaaggcttcaggtccttgagtggcatccatggagatcggtgt
gaggctgatggtaaccctcctttgttgctacttcctgaaaatgtgcggattcgaaaatat
aatctctcatctgagaagtacgcagattatcttgaagaacaggaacgtattcaggctgtt
gactatgactgggatcctgagggcataggtctcagtgtcatatattacactgtgctaggg
tatggttctaattttggtgctatcaaacgtgcctacatccccaactttgaatctggcagc
aataaccatgtgcaggtgattaacctgggcctgaaatacataatgcagccagatggatta
gcagtggactgggttggaaggcatatttactggtcagatgccaggagtcaacggattgag
gtggctaaacttgacggaaggtacagaaagtggctgattaccacccaactggatcaacca
gctgcagtggttgtgaatcccaaactcgggcttatgtactggacggactggggcaaagaa
ccaaaaatcgagtcagcttggatggatgggcagcatcggaacatcctggttcgcgaggac
cttggttggccaaccggcctttctatagattacttgaacaatgaccggatctactggagc
gacttcaaggagaaaacgattgaaaccataagatacgatgggactgatagaagaattgtt
gccagtgcagctgtggatccctacagcctcgacatctttgaaggccggttatactgggta
gctaaggataagggagaagtgtggacacaagataaatttgggcacgaggagaaagaaagg
aggctgactgtgagcccttggctcactcaagttcgagtccttcatcaacatagatacaat
cagtcagtgcccaaccgctgtaaaaatgtctgcagccatctctgcctcctgagacccgaa
ggatacagctgtgcctgtccccaaggctccaccttcttggaggggagcatgactgagtgt
aatgcagctgtggaaaatgctatggtcatgccccccccatgcaggtgtatgcacggagga
aattgctattttgatgagaatgatctccccaaatgcaagtgtcccagtggctacatggga
aattactgtgaaatagggctttcgaaaggcattcctccaggaacaacaatggccgtgctg
ttgacagtcatcctgatcatcataattggagctctggcaacattaggatttttccactac
aggaaaactggctcccttctgccctctctgcccaagctgccaagcttaagcagtcttgtc
aaatcctctgacactggaaatggggtgaccttcagatcaggggctgatgttaacatggat
attggagtggctggttttgggcccgagtctgctattgacagagcaatggtgatgagcgat
cactttaccatggagatggggaagcagcccatagtctttgaaaacccaatgtatgcaacc
agggacagtgctgtcaaagaggctcagcaaagccaggggcctctaatatttacacaggtg
actgcatctgaaaatgtagataacaagaactatgaaagtcccgtgaaccctgctgaggta
gctccagacacaaagtcagcttctgcaagtgctgatggaactcaggcaacaaagtggaat
atcttcaaacgaaaactgaaacaaactaccaacttcgaaaacccaatctacgcagagatg
gagggtgagcaaaaggaaagtgctgctggggctcctcctctgcccccgtccccttctccc
cctactaaagctcaaacgaaaaggaccccagctcctgcctattctgcgacagaagacact
tttaaagacacagcaacccttgttaaagaagactccgagatatag

DBGET integrated database retrieval system