KEGG   Miniopterus natalensis: 107546296
Entry
107546296         CDS       T05883                                 

Gene name
KCNK2
Definition
(RefSeq) potassium channel subfamily K member 2
  KO
K04913  potassium channel subfamily K member 2
Organism
mna  Miniopterus natalensis
Pathway
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
mna04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107546296 (KCNK2)
  09154 Digestive system
   04971 Gastric acid secretion
    107546296 (KCNK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107546296 (KCNK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107546296 (KCNK2)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   107546296 (KCNK2)
SSDB
Motif
Pfam: Ion_trans_2 bZIP_Maf
Other DBs
NCBI-GeneID: 107546296
NCBI-ProteinID: XP_016080154
LinkDB
Position
Unknown
AA seq 422 aa
MMNPRAKRNFYLAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVST
IFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAA
INAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPL
FGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVI
FKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVL
SMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSIKRK
LSAELAGNHSQELTPCRRTLSVNHLASERDVLPPLLKTESIYLNGLTPHCAGEEIAVIEN
IK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgatgaacccacgagcaaaaaggaacttctacttggcggcacctgacttgctggatcca
aaatctgccgctcagaactccaaaccgaggctctcgttttccacgaaacccacagtgctt
gcttctcgcgtggagagtgacacgacaattaatgttatgaaatggaagacggtctccacg
attttcctggtggttgtcctctatctgatcatcggagccaccgtgttcaaagcgctggag
cagcctcacgagatttcgcagagaaccaccatcgtgatccagaaacaaacgttcatttcc
caacactcctgtgtcaattcgactgagctggacgagctgatccagcaaatagtggcagca
ataaatgcagggattataccgttaggaaacacctccaatcaaatcagtcactgggacttg
ggaagttccttcttctttgctggcactgttattaccaccatagggtttggaaacatttca
ccacgcacagaaggagggaagatcttctgtatcatctatgccttactgggaattcccctc
tttggttttctgttggctggagttggagatcagctagggaccatatttggaaaaggaatt
gcaaaagtggaagatacgtttattaagtggaacgttagccagaccaagatccgcatcatc
tccaccatcatatttatactgttcggctgcgtgctcttcgtggctctgcccgccgtcata
ttcaagcacatagaaggctggagtgctctggacgccatttatttcgtggtcatcaccctg
acaaccatcggctttggagactacgttgctggtggatcagatattgaatatctggacttc
tataagcctgtcgtgtggttttggatccttgtaggactcgcttacttcgctgctgtcctg
agcatgattggagactggctccgggtgatatcaaaaaagacaaaggaagaggtgggagag
ttcagagcccatgctgctgagtggacggccaacgtcacggctgagttcaaggaaaccagg
aggcggctgagcgtggagatctatgacaagttccagcgcgccacctccattaagcggaag
ctgtccgcagaactggccgggaaccacagccaggagctgaccccttgcaggaggaccctg
tctgtgaaccacctcgccagcgagagggacgtcctgcctcccttactgaaaactgaaagc
atctatttgaacggattgacgccacactgtgcaggggaggaaattgctgtcattgaaaat
attaaatag

DBGET integrated database retrieval system