KEGG   Miniopterus natalensis: 107546425
Entry
107546425         CDS       T05883                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04742  Taste transduction
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04921  Oxytocin signaling pathway
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04930  Type II diabetes mellitus
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna05010  Alzheimer disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05031  Amphetamine addiction
mna05410  Hypertrophic cardiomyopathy
mna05412  Arrhythmogenic right ventricular cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107546425 (CACNA1C)
   04020 Calcium signaling pathway
    107546425 (CACNA1C)
   04024 cAMP signaling pathway
    107546425 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    107546425 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107546425 (CACNA1C)
   04929 GnRH secretion
    107546425 (CACNA1C)
   04912 GnRH signaling pathway
    107546425 (CACNA1C)
   04921 Oxytocin signaling pathway
    107546425 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    107546425 (CACNA1C)
   04924 Renin secretion
    107546425 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    107546425 (CACNA1C)
   04927 Cortisol synthesis and secretion
    107546425 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107546425 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    107546425 (CACNA1C)
   04270 Vascular smooth muscle contraction
    107546425 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    107546425 (CACNA1C)
   04727 GABAergic synapse
    107546425 (CACNA1C)
   04725 Cholinergic synapse
    107546425 (CACNA1C)
   04728 Dopaminergic synapse
    107546425 (CACNA1C)
   04726 Serotonergic synapse
    107546425 (CACNA1C)
   04720 Long-term potentiation
    107546425 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    107546425 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    107546425 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107546425 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107546425 (CACNA1C)
   05020 Prion disease
    107546425 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    107546425 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    107546425 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107546425 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107546425 (CACNA1C)
   05414 Dilated cardiomyopathy
    107546425 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107546425 (CACNA1C)
   04934 Cushing syndrome
    107546425 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107546425 (CACNA1C)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107546425 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 107546425
NCBI-ProteinID: XP_016080296
LinkDB
Position
Unknown
AA seq 1929 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIAAEDDPSPCALETGHGRQCQ
NGTVCKPGWDGPRHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVT
LIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDI
DPENEDEGMDEEKPRNRGAPAGLLDQKKGKFAWFSHSTETHVSMPTSETESVNTENVAGG
DIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIA
SEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILE
TILVETKVMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFI
IIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGP
SFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARPA
RTASPEKKQEAVEKPTVEETKEEKIELKSITADGESPPTTKINVDDLQPNENEDKSVYPN
PETTGEEEEEEPEMPVGPRPRPLSELHLKEKAAPMPEASAFFIFSPTNRFRLQCHRIVND
SIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFL
HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDG
EVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYR
VEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPL
RRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFT
GLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIV
VGSIVDIAITEVNPTEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLW
TFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFR
CATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQ
SDSRSAFPQTFTTQRPLHINKATNSPGDTESPSHEKLVDSTFTPSSYSSTGSNANINNAN
NTALGRFPRPTGYPSTVSAVEGHGPPLSPAIRVQEASWKLSSKRCHSRESQIAMVCREEF
SQDETYDVRMGEDAEYCSEPSLVSTEKLSYQDDENRQLTPPEEDKRDIRQSPKRSFLRSA
SLGRRASFHLECLKRQKHQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTTFPRP
CATPPAMPGSRGWPPQPIPTLQLEGTESSEKLNSSFPSVHCSSWSVEPTPCEGGSSATRR
ARPVSLTVPGQAGAWGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMT
IEEMENAADNILSGGAQQSPNGTLLPFVNCRDRGQDRAGGEEDGPCGPSQECRRSEEELQ
DSRAYVSSL
NT seq 5790 nt   +upstreamnt  +downstreamnt
atggtccccctgctgcacatcgccctgctagtgctgttcgtcatcatcatctacgccatc
attggcctggagctcttcatggggaagatgcataagacctgctacaaccaggagggcata
gcagcagaagatgacccctccccttgtgctctggagacgggccacgggcggcagtgtcag
aatggcactgtgtgcaagcccggctgggacgggcccaggcacggcatcaccaacttcgac
aacttcgccttcgccatgctgacggtgttccagtgcatcaccatggagggctggacggac
gtgctgtactgggtcaatgatgccgtaggaagggactggccctggatctattttgttaca
ctaatcatcatagggtcattttttgtacttaacttggttctcggtgtccttagcggagag
ttctccaaagagagggagaaggccaaggctcggggagatttccaaaagctgcgagagaag
caacagctggaagaggacctgaaaggctatctggactggatcacacaggcggaagacatc
gaccccgagaatgaagatgaaggcatggatgaggagaaaccccgaaacagaggagctcca
gcaggcttgctcgatcagaagaaagggaagtttgcttggtttagtcactccacagaaacc
catgtgagcatgcccacaagtgagacggagtctgtcaacactgagaacgtggctggcggt
gacatcgagggagaaaactgtggggccaggctggcccaccgaatctccaagtcgaagttc
agtcgctactggcgccggtggaatcggttctgcagaagaaagtgtcgcgccgcagtcaag
tccaacgtcttctactggctggtgattttcctggtgttcctcaacacgctcaccattgcc
tcagagcattacaaccagcctcactggctcacagaagtccaagacacggccaacaaggca
ctcctggcccttttcactgcagagatgctgctgaagatgtacagcctgggcctgcaggcc
tacttcgtgtccctcttcaaccgcttcgactgcttcatcgtgtgcggaggcatcctggag
accatcctggtggagaccaaggttatgtctcccttgggcatctctgtgctgagatgcgtt
cggctcctgaggatatttaaaatcaccaggtactggaactccttaagcaacctggtagca
tccttgctgaactccgtgcgctccatcgcctccctgctgctgctcctcttcctcttcatc
atcatcttctccctcctggggatgcagctcttcggaggaaagttcaactttgatgagatg
cagacccggaggagcacatttgataacttcccccagtccctcctgaccgtgtttcagatc
ctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccc
tcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactat
atcctactgaatgtgttcttggccattgctgtggacaacctggctgatgctgagagcctc
acatctgcccaaaaggaggaagaagaagaaaaggagagaaagaagctggccagaccggcc
aggactgccagcccagagaagaaacaggaggcggtggagaagccgacagtggaggagacc
aaggaggagaaaatcgagctgaaatccatcacagctgacggagagtccccacccaccacc
aagatcaacgtggatgacctgcagcccaatgaaaatgaggacaagagtgtctaccccaac
ccagaaacgacaggagaagaggaggaggaggagcctgagatgcctgtgggccctcgccca
cgccctctctctgagctgcaccttaaggaaaaggcagcgcccatgcctgaagccagtgca
tttttcatcttcagccccaccaacaggtttcgcctccagtgccaccgcattgtcaatgac
tcgatcttcaccaatctgatcctcttcttcatcctgctcagcagcatttccctggctgct
gaggaccccgtccagcacacctccttcaggaaccatattctgttttattttgatattgtt
tttactaccattttcaccattgaaattgctctgaagatgactgcttatggggctttcttg
cacaagggctccttttgccggaactacttcaacatcttggacctgctagtggtcagcgtg
tccctcatctcctttggcatccagtccagtgcaatcaacgtcgtaaagatcttgcgagtt
ctgcgagtactcaggcccctgagagccatcaacagagccaagggactaaagcatgtggtc
cagtgtgtgtttgtcgccatccggaccattggcaacatcgtgattgtcaccacactgctt
cagttcatgttcgcctgcatcggggtccagctcttcaagggaaagctctacacctgttca
gacagctccaagcagaccgaggcagaatgcaagggtaactacattacatacaaggacggg
gaggttgaccaccccatcatacagccccgcagctgggagaacagcaagtttgactttgac
aatgtcctggcagccatgatggctctcttcacggtctccacctttgaggggtggccagag
ctgctgtaccgctccatcgactcccacacggaagacaagggccccatctacaactaccgc
gtggagatctccatcttcttcatcatctacatcatcatcattgccttcttcatgatgaac
atcttcgtgggtttcgtcatcgtcaccttccaggaacagggagagcaggagtacaagaac
tgtgagctggacaaaaaccagcgacagtgtgtggaatacgccctgaaggcccggcccctg
cggaggtacatacccaagaaccagcaccagtacaaagtgtggtatgtggtcaactccacc
tacttcgagtacctgatgttcgtactcatcctgctcaacaccatctgcttggccatgcag
cactacggtcagagctgcctgtttaaaatcgccatgaacatcctcaacatgctcttcact
ggcctcttcactgtggagatgattctgaagcttattgcctttaaacccaagggttacttt
agtgatccctggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcatt
ctcagtgaaactaatcactatttctgtgatgcatggaatacgtttgacgccttgattgtt
gtgggtagcattgttgatatagcaatcaccgaggtaaacccaactgaacatacccaatgc
tctccctttatgaacgcagaggagaactcccgcatctccatcaccttcttccgcctcttc
cgggtcatgcgcctggtcaagctgctgagccgtggggagggcatccggaccctgctgtgg
accttcatcaagtccttccaggccctgccctacgtggcccttctcatagtgatgttgttc
ttcatctatgccgtgatcgggatgcaggtgtttgggaaaattgccctgaacgacaccacg
gagatcaaccggaacaacaactttcagaccttcccccaagctgtgctgctcctcttcagg
tgtgccactggggaggcgtggcaggacatcatgctggcctgcatgccagggaagaagtgc
gccccggagtctgagccccacaacagcacggaaggggagacgccctgtggcagcagcttc
gccgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctcttt
gtagctgtcatcatggacaactttgactacctgacaagggactggtcaatccttggtccc
caccatctggacgaatttaaaagaatctgggcagagtatgaccctgaagccaagggtcgc
atcaaacacctggatgtggtgaccctgctccggcggattcagcccccactgggttttggg
aagctgtgccctcaccgtgtggcttgcaaacgtctggtctccatgaacatgcctctgaac
agtgatgggacggtcatgttcaatgccaccctatttgccctggtccggacagccctgagg
atcaaaacggaagggaacctggaacaagccaatgaggagctccgggccataatcaagaag
atctggaagcggaccagcatgaagctgctggaccaagtggtgccccccgcgggtgatgat
gaggtcacagttggcaagttttatgctactttcctgatccaagagtacttccggaaattc
aagaagcgcaaggagcagggcctcgtgggcaagccctcccagaggaacgccttgtccctg
caggctggcttgcgcacgctgcacgacatcgggcctgagatccgacgggccatctccgga
gatctgacagctgaggaggagctggacaaagccatgaaggaggctgtgtctgctgcctct
gaagatgacatcttcaggagggccggtggcctgttcggcaaccatgtcagctactaccaa
agcgacagccggagcgccttcccccagaccttcaccacccagcgcccactgcacatcaac
aaggccactaacagcccaggcgacaccgagtctccgtcccacgagaaattggtggactcc
accttcacccccagcagctactcatccactggctccaacgccaacatcaacaatgccaac
aacactgccctgggccgctttccccgccccaccggctaccccagcaccgtcagtgctgtg
gagggccacgggccccccttgtctcctgccatccgggtgcaggaggcttcgtggaagctc
agctccaagaggtgccactcccgggagagccagatagccatggtgtgtcgggaggagttt
tctcaggacgagacctatgacgtgaggatgggtgaagacgcagagtactgcagtgagccc
agcctggtctccacagagaagctctcctatcaggatgatgaaaaccgacaactgacaccc
ccagaggaggacaagagggacatccggcagtctccaaagaggagcttcctccgctctgcc
tccctaggtcgaagggcctccttccacctggaatgtctaaagcgacagaagcatcaaggg
ggagacatatctcagaagacagtcctgcccttacatctggttcatcaccaggcattggca
gtggcaggcctgagccccctcctccagagaagccattctcccaccaccttccccaggcca
tgtgccacgccccctgccatgcccggcagccgaggctggcccccgcagcccatccccacc
ctgcagctcgaaggaaccgagtccagcgagaaactcaacagcagcttcccgtccgtccac
tgcagctcctggtccgtggagcccacgccttgtgagggtggcagcagcgccacccggaga
gcccggcctgtgtccctcactgtgcccggccaggcgggtgcctggggcaggcagttccac
ggtagcgccagcagtctggtggaagcggtcttgatttcggaaggactggggcagtttgcc
caagatcccaagtttatcgaggtcacaacccaggagctggctgacgcctgtgacatgacc
atagaggagatggagaacgctgctgacaacatcctcagtgggggcgcccagcagagcccc
aacggcaccctattaccttttgttaactgcagggaccgggggcaggacagagcagggggc
gaagaggacgggccctgtgggcccagccaggagtgccggaggagcgaggaggagctgcag
gacagcagagcctacgtcagcagcctgtag

DBGET integrated database retrieval system