KEGG   Miniopterus natalensis: 107546438Help
Entry
107546438         CDS       T05883                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
mna  Miniopterus natalensis
Pathway
mna04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107546438 (MAPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107546438 (MAPK6)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107546438 (MAPK6)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107546438 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 107546438
NCBI-ProteinID: XP_016080326
LinkDB All DBs
Position
Unknown
AA seq 722 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSHLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPVSSHPFHIEDEVDDILLMDETHSHIYNWERYHEC
QFSEHDWPIHNNFDIDEVQRDPRALSDVTDEEEVQIDPRKYLDGDREKYLEDPAFDTSYS
TEPCWQYPDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQTKEKSDKKGKSKCERNGLVKAQIALEEASQQLAEKEREKNQGFDFDSFIAGTIQLSSQ
REPTDVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGMANLAQLEALYQSSWDSQFVCG
GEDCFLINQFCCEVRKDEQIEKENTYTSYLDKFFSRKEDTEMLDTEPVEDGKFGERGNEE
GFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKH
LN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggctctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgaccacgataacattgtgaaagtg
tttgaaattcttggtcctagtggaagccatttaacagacgatgtgggctctcttaccgaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
caaggccccttactggaagagcatgcccggcttttcatgtatcagctgctacgtgggctc
aaatatattcattctgcaaacgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcgcggatcatggatccc
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgttcatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagccgagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttgacggcagaagaagcgctttcccatccttacatgagcatatattct
tttccaatggatgagccagtttccagtcatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcatagtcacatttataactgggaaaggtaccatgaatgt
caattttcagagcatgattggcctatacataacaactttgatattgatgaagttcagcgt
gacccaagagccctgtctgatgtcactgatgaagaagaagtacagattgatcctcgaaaa
tatttggatggagatcgtgaaaagtatttggaggatcctgcttttgatactagttactcc
actgagccttgttggcagtacccagatcatcatgaaaacaaatactgtgatctggagtgt
agccatacttgtaactacaaaatgaggtcatcatcatatttagataacttagtttggaga
gagagtgaagttaaccattattatgaacctaagcttattatagatctttccaattggaaa
gaacaaactaaagaaaaatctgataagaaaggcaagtcaaaatgtgaaaggaatggattg
gttaaagcccagatagctctagaggaagcgtcacagcagctggctgaaaaagaaagggaa
aagaaccagggatttgactttgattcctttattgcaggaactattcaacttagttcacag
cgtgagcctactgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gaattgaaaagtttgatatcaaagtcagtaagccgagaaaagcaggaaaagggaatggca
aatttggctcagttagaagccttataccagtcttcctgggatagccagtttgtgtgtggt
ggtgaggactgttttctcataaatcagttttgttgtgaggtaaggaaggatgagcaaatt
gaaaaggaaaacacttacaccagttacttggacaagttctttagtaggaaagaagatact
gaaatgctagacactgagcctgtagaagatgggaagtttggggagagaggcaatgaggaa
ggatttctgaataacagtggtgagttcctgtttaacaagcagcttgaatccataggcatc
ccgcagtttcacagtccagttgggtcaccacttaagtcaatacaggcaacattaacgcct
tctgctatgaaatcttcccctcagattcctcataaaacatacagcagcattctgaaacat
ctgaactaa

DBGET integrated database retrieval system