KEGG   Miniopterus natalensis: 107546482
Entry
107546482         CDS       T05883                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04211  Longevity regulating pathway
mna04371  Apelin signaling pathway
mna04380  Osteoclast differentiation
mna04720  Long-term potentiation
mna04722  Neurotrophin signaling pathway
mna04725  Cholinergic synapse
mna04921  Oxytocin signaling pathway
mna04925  Aldosterone synthesis and secretion
mna05031  Amphetamine addiction
mna05034  Alcoholism
mna05214  Glioma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107546482 (CAMK4)
   04020 Calcium signaling pathway
    107546482 (CAMK4)
   04024 cAMP signaling pathway
    107546482 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107546482 (CAMK4)
   04925 Aldosterone synthesis and secretion
    107546482 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    107546482 (CAMK4)
   04720 Long-term potentiation
    107546482 (CAMK4)
   04722 Neurotrophin signaling pathway
    107546482 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107546482 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    107546482 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    107546482 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    107546482 (CAMK4)
   05034 Alcoholism
    107546482 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107546482 (CAMK4)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107546482 (CAMK4)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107546482 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH Pkinase_fungal YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107546482
NCBI-ProteinID: XP_016080388
LinkDB
Position
Unknown
AA seq 636 aa
MSSDKIQSGEEASRRRLLGRGRGMWVGVIGLVGISLLLLGGGFWVVKSITNLGMANNDVS
LKITSEEILISPGPVTTTCAGCFNKLLLEEARKTPPGAPSEEFTEEPEEAELTQPPTFQC
PACECRISRGQEKGHRPSPTAQGPPWSSEPASEDSKYLPFQELRQCQRRQRQQQHRRIHS
NKRLPSKCDGISRWAFGGELGLDEVMKEGPCDRIHDLTRRNNKRGATSVVYRCKQKGTQK
PYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRI
VEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSK
IVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFM
FRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHM
DTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHSGLQEGHKAGQEPCPVQGGGEAVG
AAPEKEVPGDGAQMAVERPEAGPTEAPSSERVQEADANAAEAPEDGTEVAAPEGEEEEEG
EEELKTVTEAAAPQKGQDDPALGFGAQQNDGVLPEN
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgtcgtctgacaagatccagagtggagaggaagcttcacggaggcgtcttctggggaga
ggacgtggcatgtgggtgggagtaattggcttagtgggaatatctcttctcctccttgga
gggggattttgggtcgtaaagtcaataactaacctgggaatggcaaataatgatgtgtcc
ctaaaaatcacttctgaagaaatcctgatttccccaggtccagtcactaccacatgtgct
ggatgctttaacaaattgttattagaagaagccaggaaaactccccctggcgcccccagt
gaggaatttacggaggaaccagaggaagctgagctcacgcagccgcctacgttccagtgc
ccggcctgtgagtgcaggattagtcgaggacaggaaaaaggccatcgcccctcgcctact
gcacaaggaccaccctggtcttcagagcctgcgagtgaagacagcaaatacctgcctttt
caagagcttcgacagtgccaaaggaggcagcgccagcagcagcaccgcagaatccattcc
aacaaaagacttccctcaaagtgtgatggtatttcaagatgggcctttgggggcgaatta
gggctggatgaggtcatgaaagaggggccttgtgaccgaatccatgaccttacaagaaga
aacaacaaaaggggtgctacatccgttgtgtacagatgcaaacagaaggggactcagaag
ccttatgctctcaaagtgttaaagaaaacagtggacaaaaaaatcgtgagaactgagata
ggagttctacttcgcctctcacatccgaacattataaaacttaaagagatatttgaaact
cccacagaaatcagtctggtcctagaactcgtcacaggaggagagctgtttgacaggatt
gtggaaaaggggtattacagtgaacgagatgctgcagatgctgttaaacaaatcctggag
gctgttgcttacctccatgaaaatgggattgtccatcgtgatctcaaaccagagaatctt
ctctatgcaactccagccccagatgcaccactcaaaattgctgattttggactctccaaa
attgtggaacatcaagtgctcatgaagacggtgtgtggaacgccagggtattgtgcacct
gaaattcttagaggctgcgcctacggacctgaggtggacatgtggtctgtagggataatc
acctacatcctactttgtgggtttgaaccgttctacgacgaaagaggcgatcagttcatg
ttcaggaggattctgaattgtgaatattactttatctccccctggtgggatgaagtatct
ctaaatgccaaggacttggtcagaaaattaattgtcttggatcctaagaaacgtctgact
accttccaagctctccagcacccatgggtcacaggtaaagcagccaattttgtacacatg
gatactgctcaaaagaagctccaagaattcaacgcccggcgcaagcttaaggcggcggtg
aaggccgtggtggcctcgtcgcggctgggcagtgccagcagtagccatagcggcctccag
gagggccacaaggccggccaagagccatgccccgtccaaggcggcggcgaagctgtcggc
gccgctccagagaaggaagttccaggggacggggcccagatggccgtcgagaggccggag
gccgggcccacggaggcgccgtcctcggagcgagtccaagaggccgatgcgaatgctgcc
gaggcgccggaggacgggacagaggtggcagccccagaaggagaggaggaggaggagggg
gaggaggagctgaagactgtgacggaagcagcggccccccagaaagggcaagacgaccct
gctctgggctttggggctcagcagaatgacggggtcctgccagagaactaa

DBGET integrated database retrieval system