KEGG   Miniopterus natalensis: 107546547
Entry
107546547         CDS       T05883                                 

Definition
(RefSeq) aromatase
  KO
K07434  aromatase [EC:1.14.14.14]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
Module
mna_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107546547
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107546547
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     107546547
Cytochrome P450 [BR:mna00199]
 Cytochrome P450, animal type
  CYP19 family
   107546547
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107546547
NCBI-ProteinID: XP_016080457
LinkDB
Position
Unknown
AA seq 504 aa
MILEMLNPTHYNITSVVPEAMPIATMPILLLTGFLFLVWNYEDTSSIPGPGYCMGIGPLI
SHFRFLWMGIGSACNYYNKMYGEFMRVWVCGEETLIISKSSSMFHVMKHNHYISRFGSKL
GLQCIGMHENGIIFNNNPDLWKVVRPFFTKALSGPCLVRMVTICAESIIRHLDRLEEVRS
EAGTVDVLTLMRRIMLDTSNMLFLGIPLDENAIVIKIQGYFEAWQALLLKPDIFFKISWL
YKKYEKSVKDLKDAMEILIEEKRHRISTADKLEDCIDFATELIFAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSVFFMLFLIAKHPNIEEAIMKEIQTVVGDRDIRIDDIQKLKMVENFI
YESMRYQPVVDLVMRKALQDDIIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRSCAGKYIAMVMMKVILVTLLRRFHVQAPQGQVCADAMQIKNDLAV
HPDETSNFLDMIFIPRNSDKCLKC
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgattttggaaatgctgaacccaacgcattataacatcaccagcgtggtgccagaagct
atgcctattgccaccatgccaatcctgctgctcactggctttctctttctggtttggaat
tatgaggacacatcttcaatcccaggtcccggctattgcatgggaattgggcccctcatc
tcacacttcaggttcctgtggatggggattggcagtgcctgcaactactacaacaagatg
tacggggagttcatgagagtctgggtgtgtggagaggaaacactcatcatcagcaagtcc
tcaagtatgttccacgtaatgaagcacaatcactacatctcccgattcggcagcaaactt
gggctgcagtgcatcggcatgcatgagaatggcatcatatttaacaataatccagacctc
tggaaagttgttcggcctttcttcacaaaagctctgtcgggcccctgcctcgtgcgcatg
gtgacaatttgtgctgagtctatcataaggcacctggacaggctggaggaggtcagaagc
gaggcgggcactgtggacgtgctgaccctcatgcggcgcatcatgctggacacctccaac
atgctcttcctggggatccctttggacgaaaatgccatcgtaattaaaatccagggttat
tttgaggcatggcaagctctccttctcaaaccagacatcttctttaagatttcttggcta
tacaaaaaatatgaaaagtctgtcaaggatttgaaagatgccatggaaattctgatagaa
gaaaaaagacacaggatttccacagcagacaaactggaagactgtatagatttcgccact
gagctgatttttgctgagaagcgtggtgacctgacgagagagaatgtgaaccagtgcata
ttggagatgttgattgcagccccggacaccatgtctgtctctgtgttcttcatgctgttc
ctcattgcaaagcaccctaacattgaagaggcaataatgaaggaaatccaaactgttgtt
ggtgacagagacataaggattgatgatattcagaaattaaaaatggtagaaaactttatt
tatgagagcatgcggtaccagcctgttgtggacttggttatgcgcaaagccttacaggat
gacatcatcgatggttacccagtgaaaaaggggactaacattatcctgaacattgggaga
atgcatagactcgagtttttccccaagcctaatgaatttactcttgaaaactttgcaaag
aatgttccttacaggtattttcagccatttggttttgggccccgtagctgtgcaggaaaa
tacatcgcgatggtgatgatgaaagtcatcctggttacacttctgagacgattccacgtg
caggcaccacaaggtcaagtatgtgctgacgcgatgcagataaaaaatgacttggccgtg
cacccagatgaaactagcaactttctggatatgatttttattccaagaaattcagacaag
tgcctcaaatgctga

DBGET integrated database retrieval system