KEGG   Miniopterus natalensis: 107546622
Entry
107546622         CDS       T05883                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04144  Endocytosis
mna04218  Cellular senescence
mna04350  TGF-beta signaling pathway
mna04371  Apelin signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04659  Th17 cell differentiation
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05142  Chagas disease
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107546622 (SMAD2)
   04390 Hippo signaling pathway
    107546622 (SMAD2)
   04371 Apelin signaling pathway
    107546622 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107546622 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    107546622 (SMAD2)
   04218 Cellular senescence
    107546622 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107546622 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107546622 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107546622 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107546622 (SMAD2)
   05205 Proteoglycans in cancer
    107546622 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107546622 (SMAD2)
   05212 Pancreatic cancer
    107546622 (SMAD2)
   05225 Hepatocellular carcinoma
    107546622 (SMAD2)
   05226 Gastric cancer
    107546622 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107546622 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107546622 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107546622 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107546622 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 107546622
NCBI-ProteinID: XP_016080547
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccagttgtgaaaagactgctgggatggaagaaa
tcagctggtgggtctggaggagcaggtggaggagagcagaacggacaggaagaaaagtgg
tgtgagaaagcagttaaaagtctggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgccttcaggtatctcaccgg
aaagggctgccacacgttatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaagcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttttgcctcctgtgttagtg
ccacggcacactgagatcctcacagaactaccgcctctggatgattatacccactccatt
ccagaaaacactaacttcccagcaggaattgagccacagagtaattacatcccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttcccctgttaatcatagt
ctggatttgcagccagtcacttactcagaacctgcattttggtgttcaatagcctattat
gaattaaaccagagggttggagagaccttccatgcatcccagccctcactcactgtagac
ggcttcacagatccatcaaattcagagaggttctgcttaggcttactctccaacgtcaac
cgaaatgctacagtagaaatgacaagaagacatataggaagaggagtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
gggtttgaagccgtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcaaacagtaacgagcactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system