KEGG   Miniopterus natalensis: 107546640
Entry
107546640         CDS       T05883                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
mna  Miniopterus natalensis
Pathway
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04310  Wnt signaling pathway
mna04350  TGF-beta signaling pathway
mna04371  Apelin signaling pathway
mna04390  Hippo signaling pathway
mna04520  Adherens junction
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04659  Th17 cell differentiation
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05161  Hepatitis B
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05220  Chronic myeloid leukemia
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107546640 (SMAD4)
   04350 TGF-beta signaling pathway
    107546640 (SMAD4)
   04390 Hippo signaling pathway
    107546640 (SMAD4)
   04371 Apelin signaling pathway
    107546640 (SMAD4)
   04068 FoxO signaling pathway
    107546640 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107546640 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107546640 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    107546640 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107546640 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107546640 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107546640 (SMAD4)
   05212 Pancreatic cancer
    107546640 (SMAD4)
   05225 Hepatocellular carcinoma
    107546640 (SMAD4)
   05226 Gastric cancer
    107546640 (SMAD4)
   05220 Chronic myeloid leukemia
    107546640 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107546640 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107546640 (SMAD4)
   05161 Hepatitis B
    107546640 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 107546640
NCBI-ProteinID: XP_016080579
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATNTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctataacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataaccgcc
attactacaaatggagctcatcctagcaaatgtgttaccatacagagaacattggatgga
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcgttatccactgaaggacattcaattcaa
accatccaacatccaccaagtaatcgtgcatcgaccgagacatacagcaccccagctctg
ttagctccatctgagtctaatgctaccaacaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaacgagcttgccttccagcctcccatttccaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatatgtggacccttctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaaga
ttgcacataggcaaaggtgtacagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgcctcagtgaccacgcagtctttgtacaaagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgtcagatgcagcagcaggcggccactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggccctggatcagtaggtggaatagctcca
gctatcagtttgtcagctgctgctggaattggggttgatgaccttcgtcgtttatgcata
ctcaggatgagttttgtgaaaggctggggaccagattacccaagacagagcatcaaagaa
acgccttgctggattgagattcacttacaccgggccctccagctcctagatgaagtactt
cacaccatgcctattgccgacccacaacctttagactga

DBGET integrated database retrieval system