KEGG   Miniopterus natalensis: 107546683Help
Entry
107546683         CDS       T05883                                 

Gene name
WBSCR17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mna  Miniopterus natalensis
Pathway
mna00512  Mucin type O-glycan biosynthesis
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107546683 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mna01003]
    107546683 (WBSCR17)
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     107546683 (WBSCR17)
Glycosyltransferases [BR:mna01003]
 O-Glycan biosynthesis
  Mucin-type
   107546683 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 107546683
NCBI-ProteinID: XP_016080621
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIALRSGDGFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAASGQ
ITGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGSTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgctggtgttgaacttgatagcggtggccggc
ttcgtgctctttctggccaagtgccggcccatcgcattgcgcagcggagacggcttccac
gagattcggccgcgtgccgaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctctcgctgctggaggacatcgtctacaggcaactgaatggc
ttatccaaatcccttgggctcattgaaggttatggcgggcggggcaaagggggccttcct
gccaccctttccccagctgaagaagaaaaagccaagggcccccacgagaagtatggctac
aattcctacctcagtgagaaaatctcgctggatcgttctattccggattatcgccccacc
aagtgtaaggagctgaagtactccaaggagctgccccagatatccatcattttcatcttt
gtgaacgaggccctgtcggtgatcctgcggtcggtccacagtgctgtcaaccacacgccg
acacacctgctgaaggaaatcatcctggtggatgacaacagtgacgaagaggagctgaag
gcccccttggaggagtacgtccacaaacgctacccggggctggtcaaggtggtgcgcaat
caaaagagagagggcctgatccgagcacgtatcgagggctggaaggcggccagcggccag
atcactggcttctttgatgcccacgtggaattcaccgcaggctgggccgagccggttctc
tcccgaatccaggagaacaggaagcgcgtgatcctcccgtccatcgacaacatcaagcag
gacacctttgaggtgcagcggtacgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccgaaagactggtgggacgccggagacccttctctccccatc
agaacaccagccatgattggctgctccttcgtggtcaacaggaagttctttggtgaaatc
ggtcttctggaccctgggatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtgtggctctgcgggggcagcatggaggtcctgccttgctcacgggtggcccacatcgaa
cggaagaagaagccatacaacagcaacatcggcttctacaccaagaggaatgctctccgg
gtggctgaggtctggatggacgattacaagtctcatgtgtacatagcgtggaacctgccg
ctggagaacccaggaattgacataggtgatgtctctgaaagaagagccttaaggaaaagt
ttaaagtgtaaaaatttccagtggtacctggaccacgtttacccagaaatgagaagatac
aacaacaccattgcatacggggagcttcgaaacaacaaggcaaaagacgtctgcttggac
caggggccactggagaaccacacagcaatactgtacccatgccacggctggggaccccag
ctcgcccgctacaccaaggaaggctttttgcacttgggagccctggggagcaccacgctc
ctccctgacacccgctgcctggtagacaactccaagagtcggttgccccagttgcttgac
tgtgacaaggtcaagagcagcctgtacaagcggtggaacttcatccagaacggagccatt
atgaacaagggcacggggcgctgcctggaggtggagaaccggggcctggctggcattgac
ctcatcctccgcagctgcacgggccagaggtggacgattaagaattccatcaagtag

DBGET integrated database retrieval system