KEGG   Miniopterus natalensis: 107546709
Entry
107546709         CDS       T05883                                 

Gene name
PDE3B
Definition
(RefSeq) cGMP-inhibited 3',5'-cyclic phosphodiesterase B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04371  Apelin signaling pathway
mna04910  Insulin signaling pathway
mna04914  Progesterone-mediated oocyte maturation
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107546709 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107546709 (PDE3B)
   04024 cAMP signaling pathway
    107546709 (PDE3B)
   04022 cGMP-PKG signaling pathway
    107546709 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107546709 (PDE3B)
   04922 Glucagon signaling pathway
    107546709 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    107546709 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    107546709 (PDE3B)
   04924 Renin secretion
    107546709 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107546709 (PDE3B)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107546709 (PDE3B)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 107546709
NCBI-ProteinID: XP_016080676
LinkDB
Position
Unknown
AA seq 794 aa
MILWDWDLKQWYKPHYQNSGGGSGVDLSVLNEARNMVSDLLIDPTLSPQVISSLRSISSL
MGAFSGSCRPKINPLTPFPGFYPCSEIEDPVERGDRKIHKGLHSRNSLPTPQLRRSSGAS
SLPPIEPSSRWERNNGKRPHQESGVSSQGCYLNGPFSSNPLTVPKQRSSSVSLTHHIGLR
RAGVLPSLSPVNSPGHGPVSPGSLTSRSPIEFPDTADFLTKPSVILHRSLGNAPTSPDFY
PPLRNSDSNLCNSCGHQILKYVSTPESESGTDCCGGKSGDEDNTISSKESLNLTEAQQEV
ETENRDCRKLALEDDNHLTEEAQNAQQPNIEQEASLDRVLIEDYDSLIEKMSNWNFQIFE
LVEKMGENSGRILSQVMYTLFQDTGLLEIFRIPTLQFMNYFHALENGYRDIPYHNRIHAT
DVLHAVWYLTTRPIPGLQQIHSDPGTGNETESDGRINPGRIAYISSRSCSIPDESYGCLS
SNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWSLYL
SSPEYNFLLNLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNSNGIEWSNEN
DRLLVCQVCIKLADINGPAKVRNLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRSSPQ
LAKLQESFITHIVGPLCNSYDAAGLLPGQWVEAEEEEDAESCYDDDGEESDTDEEEIEDN
LDPKPQRRKGRRRIFCQLMHHLTENHKVWKEMVEEEEKCPAEDTQPQAEGAPIPQADEIQ
VIEEADEEEERQCE
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgattctttgggattgggacttaaagcaatggtataaacctcattatcagaattctgga
ggtggaagtggagtggatctttcagtgctaaatgaggctcggaatatggtgtcagacctt
ctgattgatccgaccctttccccacaagtcatttcttcccttcgaagtatcagtagcttg
atgggtgctttctcaggttcctgtaggccaaagattaatcctctcacaccgtttcctgga
ttttacccctgctctgaaatagaggacccagtggagagaggagatcgaaaaatccacaag
ggactacacagtaggaatagtttaccaactccacagctgaggaggagctcaggagcttca
agtctgccacctattgaaccttcttcaaggtgggaacgcaataatggcaaaaggcctcac
caagaatctggtgtttcaagccaaggatgctatctaaatgggccttttagttcaaaccca
ctgacagtcccgaagcaaaggtcatcttctgtgtcgctaactcaccatataggtctaaga
agagctggtgttttaccgagcctgagtcccgtgaattctcctggccatggaccagtgtct
cctggctctctaactagtcgatcgcctatagaatttcctgatactgctgattttcttact
aagccaagtgttattttacacagatctctgggcaatgcacccacttcaccagatttttat
ccgccacttagaaattctgatagcaatttatgtaacagctgtggacatcaaatactgaaa
tatgtttcaacacctgaatcagagtctggtacagattgctgtggcgggaaatcaggggac
gaagacaacaccatttcctcaaaagaatcactcaaccttacagaagctcaacaagaagtg
gaaacagagaacagagactgcagaaaattagctctggaagatgataatcacctaacagaa
gaggcacagaatgcacagcaaccaaatattgaacaggaagcatcactggaccgggtttta
atagaagattatgattcattaatagaaaagatgagcaactggaactttcaaatttttgaa
cttgtagaaaaaatgggagagaattcaggaaggatccttagtcaggttatgtatacttta
tttcaagacactggtttattggaaatatttagaattcccactctacaattcatgaactac
tttcatgcattagaaaatggctatcgagacattccttatcacaatcgtatacacgccaca
gacgtcctacatgccgtttggtatctgacaacacggccaattcctggcttacagcagatc
cacagtgatcctggaacaggaaacgaaacagagtctgatggtagaattaaccctgggcga
attgcttacatttcttcgaggagctgctcaatcccagatgagagctatggctgcctgtct
tcaaacatccctgcgttggaattgatggctttgtacgtggcagctgccatgcacgattat
gaccacccagggcggacaaatgcatttctagtggctacaaatgcccctcaggcggtctta
tacaacgacagatctgttctggagaatcatcatgctgcatcagcttggagtctgtatctt
tctagcccagaatacaacttccttctgaacctcgatcacgtggaattcaagcgctttcgt
tttttagtcattgaagccatccttgccacagaccttaagaagcattttgatttccttgct
gaattcaatgccaaggccaatgatgtaaatagcaacggtatagaatggagtaatgaaaac
gaccgcctcttagtatgccaggtgtgcatcaaactggcagacataaacggcccagcaaaa
gttcggaacttgcatttgaaatggacagaaggcattgtcaatgaattttatgagcaggga
gacgaagaagccaatctcggtttgcccatcagccccttcatggatcgatcctctccgcag
ctggccaagctccaggagtccttcatcacacacatcgtgggccccctgtgcaactcctac
gatgctgccggtctgctcccaggccagtgggtggaagcggaagaggaggaggatgccgag
agttgttacgatgacgatggtgaagagtccgatacagatgaggaagaaatagaagacaac
ctggatcccaagccgcagagaaggaaaggcaggcggcgaatattctgccagctgatgcac
cacctcaccgagaaccacaaggtgtggaaggagatggtggaggaggaggagaagtgccca
gcggaggacactcagccgcaggcggagggcgcgcccatccctcaggccgacgagatccag
gtcatcgaggaggcggacgaagaggaggagagacagtgcgaatga

DBGET integrated database retrieval system