KEGG   Miniopterus natalensis: 107546732
Entry
107546732         CDS       T05883                                 

Definition
(RefSeq) calcitonin gene-related peptide 2-like
  KO
K12332  calcitonin
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107546732
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107546732
SSDB
Motif
Pfam: Calc_CGRP_IAPP DUF3915
Other DBs
NCBI-GeneID: 107546732
NCBI-ProteinID: XP_016080701
LinkDB
Position
Unknown
AA seq 133 aa
MGFWKYSPFLALGILVLYQAGVLQAAPFRSVLESRPDPASEAEDELCLILAAMVKDYVQK
KMSDVEREREREQEQETEDISITAQKRACNTATCVTNKLAALLSRSGAVVKNNFVPTYVG
SRAFGRRRRDLWD
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggcttctggaagtactcgcccttcctggctcttggcatcctggtcctgtaccaggca
ggagtcctccaggcagcaccattcaggtctgtcctggagagccgccccgaccctgcttcg
gaggcagaggacgagctgtgcctcatcctggctgccatggtgaaggactacgtgcagaag
aagatgagtgatgtggagcgggagcgggagcgggagcaggagcaggagaccgaggacatc
agcatcactgctcagaagagagcctgcaacactgctacctgcgtgaccaacaagctggca
gccttgctgagcaggtctggggcagtggtgaagaacaactttgtgccaacctatgtgggc
tccagagccttcggccgccgccgccgtgacctgtgggactaa

KEGG   Miniopterus natalensis: 107546742
Entry
107546742         CDS       T05883                                 

Definition
(RefSeq) calcitonin gene-related peptide 2-like
  KO
K12332  calcitonin
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107546742
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107546742
SSDB
Motif
Pfam: Calc_CGRP_IAPP DENND11 DUF2333
Other DBs
NCBI-GeneID: 107546742
NCBI-ProteinID: XP_016080706
LinkDB
Position
Unknown
AA seq 132 aa
MGFGKSSPFLAFSILVLCQAGGLQAARLRSALESLPDTDSAALSEKEGYLLLAALLKAYV
QKKTSELEQEVQEQKTKDSSVTSQKRSCNTSTCAIERLADVLSKFGGMAKNDFVPTDVGP
GSYGRRRRDLQA
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggcttcgggaagtcctcccccttcttggctttcagcatcttggtcctgtgccaggca
ggcggcctccaggcagcacggctcagatcagctttggagagcctcccagacaccgactct
gctgcactcagtgagaaggaaggctacctcctactggctgcactgttgaaggcctatgta
cagaagaagaccagtgagctggagcaggaggtgcaggagcagaagacgaaggactccagt
gtcacttcccagaagagatcctgtaacacttccacatgtgcgatcgaaaggctggcagat
gtgctgagcaaattcgggggaatggcgaagaacgacttcgtgcccaccgatgtgggcccc
ggtagctatggccgtcgccgtagagaccttcaggcctga

KEGG   Miniopterus natalensis: 107546743
Entry
107546743         CDS       T05883                                 

Definition
(RefSeq) calcitonin gene-related peptide 1-like
  KO
K12332  calcitonin
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107546743
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107546743
SSDB
Motif
Pfam: Calc_CGRP_IAPP ATP19
Other DBs
NCBI-GeneID: 107546743
NCBI-ProteinID: XP_016050923
LinkDB
Position
Unknown
AA seq 124 aa
MRFGKFLPFLALGILVLYQAGLLQATPFSSDSEDTSNPASLNEEEDLLLAILVKELLKKM
AREKEQVTAGSSFTAQKRACNTGTCLTQKLAGLLSRSGSVAHKNLLPSSMVSNAAPRKAR
DLDA
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcgcttcgggaagttcttacccttcctggctcttggcatcctggtcctgtaccaggcg
ggactgctccaggcaacaccattcagttctgactcggaggacacctccaatcctgcttcc
ctcaatgaggaagaagacctccttctggccatactggtgaaggagttgctgaagaagatg
gcccgggagaaggagcaggtgacagcgggctccagcttcactgcccagaagagagcctgc
aacactggcacctgcttgacccaaaagcttgcaggcttgctgagcaggtctggaagtgtg
gcacacaagaacttgctgccttctagcatggtctccaatgccgctccccggaaagccagg
gatcttgatgcgtaa

DBGET integrated database retrieval system