KEGG   Mycolicibacterium neoaurum: D174_00005Help
Entry
D174_00005        CDS       T02959                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mne  Mycolicibacterium neoaurum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AHC23085
UniProt: V5XH35
LinkDB All DBs
Position
142..1206
Genome map
AA seq 354 aa AA seqDB search
MRLPVMPPVSPMLAKPVREIPPGASYEPKWDGFRSILFRDGDEVELGSRNERPLTRYFPE
LVAAARAELPPRCVVDGEIVIAGNTGLDFEALQLRLHPAVSRVTKLATETPAAFIAFDLL
ALGDEDLTGQPFSRRRSALTAALTDRGPTFHLTPATTDEGTAARWFTDFEGAGLDGLIAK
PLDGVYQPDKRVMFKVKHARTADCVVAGYRLHKSGDDAIGSLMLGLYGDDGSLASVGVIG
AFTMARRRELFHELQPLVTTFDEHPWNWAAHVPVEPTVRRTANSRWNPDKSLSFTPLRPE
RVVEAKYDQLEGKRFRHTAQFGRWRPDRDPRSCTFEQLEVPTSFRLADIVPGLG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcccgtcatgccaccggtgtcgccgatgctggccaaacccgtgcgcgagata
ccgcccggtgcatcatatgaaccgaaatgggacggcttccggtccatcctgttccgcgac
ggcgacgaggtggagctgggcagccgcaacgagcggccgctgacgcgctacttccccgaa
ctcgtcgccgcggcccgcgcagagttgccgccgcggtgcgtggtcgacggtgaaatcgtc
atcgccggcaacacaggactcgatttcgaggcgctgcagttgcggctgcatcccgcggtg
tcgcgggtgaccaagctggctaccgagaccccggcagcgttcatcgccttcgacctgctc
gcactcggtgacgaggacctgaccgggcagcccttcagcaggcgccgatcggcactgacc
gcggcactgaccgaccgcggacccaccttccacctcaccccggcgaccaccgacgaaggc
accgcggctcgctggttcaccgacttcgaaggcgccgggttggacgggttgatcgccaaa
ccgctcgacggcgtctaccaacccgacaagcgagtcatgttcaaggtcaagcacgctcgc
acggcggactgcgtggtggccggatatcgattgcacaagtcgggcgatgacgccatcggt
tcgctgatgctcggcctctacggcgacgatggttcgctggcatcggtcggagtcatcggg
gcgttcaccatggcgcgccgccgcgagttgttccacgaattgcagccactggtgaccact
ttcgacgagcacccgtggaattgggcggcgcatgtcccggtcgagccgacagtccgccgt
actgcgaactcacgctggaatccggacaagagcctgtcattcaccccgttgcgacccgag
cgggtggtcgaggcgaagtacgaccagttggagggaaagcggtttcggcacaccgcccag
ttcggtaggtggcgcccggaccgtgatccgcggtcgtgcaccttcgagcaactcgaggtt
ccgacaagcttccgcctcgcggacatcgtgccaggattgggttga

DBGET integrated database retrieval system