KEGG   Mycolicibacterium neoaurum: D174_00240Help
Entry
D174_00240        CDS       T02959                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00071  Fatty acid degradation
mne00280  Valine, leucine and isoleucine degradation
mne00281  Geraniol degradation
mne00310  Lysine degradation
mne00360  Phenylalanine metabolism
mne00362  Benzoate degradation
mne00380  Tryptophan metabolism
mne00410  beta-Alanine metabolism
mne00627  Aminobenzoate degradation
mne00640  Propanoate metabolism
mne00650  Butanoate metabolism
mne00903  Limonene and pinene degradation
mne00930  Caprolactam degradation
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01120  Microbial metabolism in diverse environments
mne01130  Biosynthesis of antibiotics
mne01212  Fatty acid metabolism
Module
mne_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D174_00240
   00650 Butanoate metabolism
    D174_00240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D174_00240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D174_00240
   00310 Lysine degradation
    D174_00240
   00360 Phenylalanine metabolism
    D174_00240
   00380 Tryptophan metabolism
    D174_00240
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D174_00240
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D174_00240
   00281 Geraniol degradation
    D174_00240
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D174_00240
   00627 Aminobenzoate degradation
    D174_00240
   00930 Caprolactam degradation
    D174_00240
Enzymes [BR:mne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     D174_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AHC23118
UniProt: V5X5N5
LinkDB All DBs
Position
43333..44142
Genome map
AA seq 269 aa AA seqDB search
MAYESVTVDIADHVARVTLIGPGKGNAMGPAFWAEMPEVFATLDADPAVRAIVLTGSGKN
FSYGLDLAAMGATLPGLDAGAKARHDFHKTILTMQQAISAVADCRTPTIASVHGWCIGGG
VDLISAVDIRYASADAKFSVREVKLAIVADVGSLARLPLIVSDGHLRELALTGKDIDAAR
AEKIGLVNDVHADADASLAAAHATAAEIAANPPLTVHGVKDVLDQQRIARVSESLRYVAA
WNSAFLPSKDLGEAVTAMFGKRAPQFTGE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaatccgtgaccgtggacatcgccgatcatgtcgcccgagtgacactcatc
ggccccggcaagggcaatgcgatgggacccgccttctgggccgagatgccggaggtgttc
gccaccctcgacgccgaccccgcggtccgggccatcgtgctcactgggtccggcaagaac
ttcagctacgggctggacctggccgcgatgggcgccaccctgcccgggctggacgccggc
gccaaggcccggcacgacttccacaagacgatcctgaccatgcagcaggccatcagcgcg
gtcgccgactgccgcacccccaccatcgcctcggtgcacggctggtgcatcggcggcggg
gtcgacctgatcagcgccgtcgacatccgttacgccagcgccgatgccaagttctcggtc
cgtgaggtcaagctcgcgatcgtcgccgatgtgggctcgctggcccgccttccgctgatc
gtgtccgacgggcatctgcgcgaactcgcattgaccggcaaggacatcgacgccgcgcgc
gccgagaagatcggcctggtcaacgatgtgcacgccgacgccgatgcgtcgctggccgcc
gcgcacgccaccgccgccgagatcgccgccaacccgccactgaccgtgcatggtgtcaag
gacgtcctggaccaacagcgcatcgcccgggtctcggagagcctgcgctatgtggcggcg
tggaattcggcgttcctgccgtccaaggatctcggcgaggcggtcaccgcgatgttcggc
aagcgcgcccctcaattcaccggggagtag

DBGET integrated database retrieval system