KEGG   Mycolicibacterium neoaurum: D174_00590Help
Entry
D174_00590        CDS       T02959                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mne  Mycolicibacterium neoaurum
Brite
Enzymes [BR:mne01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     D174_00590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHC23177
UniProt: V5X599
LinkDB All DBs
Position
121275..121898
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGVNDAVAKLEEARANDDQSAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPEGDLAAAIDDQFGSFDKFRAQFTAAANGL
QGSGWAVLGYDSLGQRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQDRYAKATAKTGGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccctgcccgacctcgattacgactacggcgccctggaaccccacatc
tccggccagatcaacgaactgcaccacagcaagcaccacgccacctacgtcaagggtgtc
aacgacgccgtggccaagctcgaagaggcccgcgccaacgacgaccagtcggcgatcttc
ctcaacgagaagaacctggccttccacctcggcggccacgtcaaccacagcatctggtgg
aagaacctctcccccaacggcggcgacaagcccgaaggcgacctcgcggccgccatcgac
gaccaattcggcagcttcgacaagttccgcgcccagttcaccgccgcagccaacggcctg
cagggctccggctgggccgtcctgggctacgacagcctcggccagcgcctgctgaccttc
cagctctacgaccagcaggccaacgtcccgctgggcatcatcccgctgctgcaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtcaaggcc
ttctggaacgtcgtcaactgggccgacgtccaagaccgctacgccaaggcaaccgccaag
accggcggcctcatcttcgggtaa

DBGET integrated database retrieval system