KEGG   Mycolicibacterium neoaurum: D174_07390Help
Entry
D174_07390        CDS       T02959                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00250  Alanine, aspartate and glutamate metabolism
mne00410  beta-Alanine metabolism
mne00430  Taurine and hypotaurine metabolism
mne00650  Butanoate metabolism
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01120  Microbial metabolism in diverse environments
mne02024  Quorum sensing
Module
mne_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D174_07390
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D174_07390
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D174_07390
   00430 Taurine and hypotaurine metabolism
    D174_07390
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D174_07390
Enzymes [BR:mne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     D174_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AHC24418
UniProt: V5X9C4
LinkDB All DBs
Position
1527390..1528793
Genome map
AA seq 467 aa AA seqDB search
MPNVSRHSSLSPAYTGRLSTSPIPALRLPDESMEPEQTYRFIHDELMLDGSSRLNLATFV
TTWMDPEADRLMSETFDKNMIDKDEYPVTAAIEQRCVCMVADLFHAEDLRDDDPSTAVGV
STVGSSEAVMLAGLAMKWRWRAKIGGAKGDGWKGRTPNLVMGSNVQVVWEKFCRYFDVEA
RYLPMADGRYVITPEQVLDAVDEDTIGVVGILGTTYTGELEPIGEICAALDRLAKDKGLD
IPVHVDAASGGFVVPFLHPDVVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRNKEYLPE
ELVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYLQVMRCLSETAQWLAREL
AAMTVDHKQLFEVITDGSAIPVVAFKLATDTPYTVFDISAMLRSYGWQLPAYTMPDDATD
VAVLRIVVREGFSANLARALRDDLVEVLGKLSKVGIGGFADEEHFAH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgtctcccgtcattcctcgctgagccccgcctacaccggacggctgtcgacc
agcccgatcccggccttgcggttgccggacgagtcgatggagcccgagcagacctatcgc
ttcatccacgacgagctcatgctcgacggtagttcgcggctgaacctcgcgacgttcgtc
accacctggatggatcccgaggccgaccggctgatgtcggagacgttcgacaagaacatg
atcgacaaggacgagtatccggtcaccgcggccatcgagcagcgctgtgtgtgcatggtt
gccgacctgttccacgccgaagatctgcgcgacgacgatccgtcgacggcggtcggggtg
tcgaccgtcggctcgagcgaggcggtcatgctggccggtctggcgatgaaatggcgctgg
cgcgccaagatcggtggcgccaagggcgacgggtggaagggccgcaccccgaacctggtg
atgggctccaacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgaggcc
cggtacctgccgatggccgacggacgctacgtcatcacccccgagcaggtgctcgacgcc
gtggacgaggacaccatcggcgtggtcggcatcctgggcaccacctacaccggcgagttg
gagcccatcggtgagatctgcgccgccctcgaccgcctggccaaggacaagggactcgac
atcccggtccacgtcgacgcggccagcggcggtttcgtcgtcccgttcctgcatccggac
gtggtgtgggatttccggttgccgcgcgtggtttcgatcaacgtcagcggccacaagtac
gggctgacctacccgggcatcggcttcgtggtgtggcgcaacaaggagtacctgcccgag
gaactggtcttccgggtcaactacctcggcggcgacatgccgacattcacgctgaacttc
tcccgcccgggcaaccaggtggtcggccagtactacaacttcctgcgcctgggcagggag
ggctatctgcaggtgatgcgctgcctgtcggagaccgcgcaatggctggccagggaactc
gccgcgatgacggtcgaccacaagcagttgttcgaggtcatcaccgacggatcggccatc
ccggtggtcgcgttcaagctggccaccgacaccccctacacggtgttcgacatctcggcg
atgttgcgaagctacggctggcagctgccggcctacaccatgcccgacgatgccaccgac
gtcgcggtcctgcggatcgtcgtgcgtgagggtttctcggcgaacctggcccgcgcactg
cgcgacgatctggtcgaggtgctgggcaaactgtccaaggtcggcatcggcggcttcgcc
gacgaggagcatttcgcccactga

DBGET integrated database retrieval system