KEGG   Mycolicibacterium neoaurum: D174_07395Help
Entry
D174_07395        CDS       T02959                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00473  D-Alanine metabolism
mne01100  Metabolic pathways
mne01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mne00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    D174_07395
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    D174_07395
Enzymes [BR:mne01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     D174_07395
Peptidoglycan biosynthesis and degradation proteins [BR:mne01011]
 Precursor biosynthesis
  Racemase
   D174_07395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHC24419
UniProt: V5XAI2
LinkDB All DBs
Position
1528819..1529967
Genome map
AA seq 382 aa AA seqDB search
MITTENVPRAIVDLDAIAHNVTELREHAGSAAVMAVVKADGYGHGAVRVAQAALAAGAAE
LGVATVAEAAALQSGGVTAPLLAWLHAPDTDFAPAVRTGVQLAVSSAAELSGVLDAVRRT
GDTATVTVKADTGLSRNGVSPAEFDEVLAALATAQADGSVRVRGLMSHLAHGDTPDHPFN
GIQGDRLREFAARARRHGIHFELLHLANSPAALTRPDLAFDMVRPGIAVYGQTPIPERGA
MGLRPAMTVACPVAKIRALRAGDGVSYGHTWVADRDTTVALIPAGYADGVFRSLSNRLEV
AINGRRYPAVGRVCMDQFVVDLGPDGAGVNVGDAAILFGPGDRGEPTAQDWADLLGTINY
EVVTSPRGRIVRSYTGGPEGTP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaccaccgagaacgtcccgcgtgcgatcgtcgacctcgacgccatcgcccataac
gtcaccgaactgcgcgaacatgccggttcggccgccgtgatggccgtggtcaaggcggac
ggatacggccatggcgcggtccgcgtcgcgcaggcggcgttggccgcaggtgccgccgag
ctgggcgtggcgaccgtcgccgaagccgccgcgctgcagtcgggcggcgtgaccgcgccg
ctgctggcctggctgcacgcgccggacaccgatttcgctcccgccgtgcggaccggggtg
cagctggcggtgtcctcggccgccgagctctcaggcgtgctcgacgcggtgcggcgtacc
ggcgacaccgccacggtcaccgtgaaggccgacaccgggctcagccgcaacggtgtgtcg
cccgccgagttcgacgaggtactggcggcgctggccaccgcccaggccgacggttcggta
cgggtgcgtggcctgatgtcgcacctggcacacggggacaccccagatcatccgttcaac
ggcatccagggcgaccggctgcgtgagttcgcggcccgggcccggcgccacggtatccac
ttcgagctgctgcacctggccaattcgccggccgcgctgacccgacccgatctggcgttc
gacatggtgcgcccaggaatagcggtgtatggacagaccccgatccccgagcgcggcgcg
atggggctgcgaccggcgatgacggtggcctgcccggtggccaagatccgggcactgcgg
gcaggcgacggcgtttcctacggtcacacctgggttgccgaccgcgacaccacggtggcg
ttgatcccggccggctacgccgacggcgttttccgctcgctgagcaaccggctggaggtg
gccatcaacggccgtcggtatcccgccgtgggccgggtctgcatggatcagttcgtggtg
gatctgggtcccgacggggccggggtgaacgtgggggacgcggcgatcctgttcgggccg
ggcgaccgtggcgaaccgaccgcgcaggactgggccgatctgttgggcaccatcaactac
gaggtggtgaccagtccgcgcgggcgcatcgtgcgcagttacaccggtggtccggagggc
accccgtga

DBGET integrated database retrieval system