KEGG   Mycolicibacterium neoaurum: D174_12545Help
Entry
D174_12545        CDS       T02959                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00250  Alanine, aspartate and glutamate metabolism
mne00280  Valine, leucine and isoleucine degradation
mne00310  Lysine degradation
mne00410  beta-Alanine metabolism
mne00640  Propanoate metabolism
mne00650  Butanoate metabolism
mne01100  Metabolic pathways
mne01120  Microbial metabolism in diverse environments
Module
mne_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D174_12545
   00650 Butanoate metabolism
    D174_12545
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D174_12545
   00280 Valine, leucine and isoleucine degradation
    D174_12545
   00310 Lysine degradation
    D174_12545
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D174_12545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mne01007]
    D174_12545
Enzymes [BR:mne01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     D174_12545
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     D174_12545
    2.6.1.48  5-aminovalerate transaminase
     D174_12545
Amino acid related enzymes [BR:mne01007]
 Aminotransferase (transaminase)
  Class III
   D174_12545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AHC25359
UniProt: V5XD62
LinkDB All DBs
Position
complement(2611016..2612359)
Genome map
AA seq 447 aa AA seqDB search
MPAVEQSRHLATAIPGPKSSALIERKNSAVARGVGTTMPVYAARAAGGILEDIDGNRLID
LGSGIAVTTIGNAAPRVVDAVTAQVDLFTHTCFMVTPYEGYVAVAEHLNRLTPGSGDKRS
ALFNTGSEAVENAIKIARSYTRKQAVVSFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPFRDAEFGKELAEDGELAAKRAITVIDKQIGADNLAAVIIEPIQGEGGFIVP
APGFLPALLAWCRDNNVVFIADEVQTGFARTGAMFACEHEGIEPDLIVTAKGIADGLPLS
AVTGRAEIMDAPHVSGLGGTYGGNPIACAAALATIETIETDGLVARAGAIERLMKDRLHR
MQADDDRIGDVRGRGAMIAVELVKSGGTEPDADLTKALCAAAHAKGVIVLSCGTYGNVLR
FLPPLAISDDLLNEALEILAEALAALR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccgtcgaacagagccgccatctcgccaccgccatccccggcccgaagtcctcg
gcgctgatcgagcgcaagaattccgcggtcgcccgcggtgtcggcacgacgatgcccgtc
tacgccgcacgtgccgccggcggcatcctggaggacatcgacggcaaccggctgatcgac
ctcggttcgggcattgccgtcaccaccatcggcaacgccgcgccgcgggtggtcgacgcg
gtgaccgcgcaggtcgatctgttcacccacacctgcttcatggtgacgccctacgagggt
tacgtcgccgtggccgaacacctcaaccggctcacccccggcagcggggacaagcgttcg
gcgctgttcaacaccggatccgaggcggtcgagaacgcgatcaagatcgcccgctcctac
acccgcaagcaggccgtggtgtccttcgaccacgcctatcacggccgcaccaacctcacg
atggcgctgaccgccaaatcgatgccctacaagagtggtttcggcccgttcgccccggag
atctaccgggctccgctgtcgtatcccttccgcgacgcggagttcggcaaggagttggca
gaggacggcgaactggcggccaagcgcgccatcaccgtcatcgacaagcagatcggcgcc
gacaacctggccgccgtcatcatcgagcccatccagggcgagggcggattcatcgtcccc
gcaccgggattcctgcccgcactgctcgcctggtgccgggacaacaatgtggtgttcatc
gccgacgaggtgcagaccgggttcgcgcggaccggggcgatgttcgcctgtgagcacgag
ggcatcgaacccgacctgatcgtcaccgcgaagggcatcgccgacgggctgcccctctcg
gcggtcaccgggcgcgccgagatcatggatgccccgcacgtgtccgggctcggcggcacc
tacggcggcaatccgatcgcctgcgccgcggcgttggcgaccatcgagaccatcgagacc
gacggcctggtggcccgcgccggtgccatcgaacggctcatgaaggaccggctgcaccgg
atgcaggccgacgacgaccggatcggcgatgtgcgtggccgcggtgcgatgatcgccgtg
gaactggtcaagtccggtggcaccgaacccgatgcagatctgaccaaggcgctgtgcgcg
gccgctcacgccaagggtgtcatcgtgttgtcctgcggtacctacggcaacgtgttgcgt
ttcctgccgccgctggcgatcagcgacgacctgctgaacgaggccctcgagatcctggcc
gaggcgctggccgcacttcgctga

DBGET integrated database retrieval system