Mycolicibacterium neoaurum VKM Ac-1815D: D174_18775 Help Entry D174_18775        CDS       T02959                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mne  Mycolicibacterium neoaurum VKM Ac-1815D Pathway mne00261   Monobactam biosynthesis mne01100   Metabolic pathways mne01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mne00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D174_18775  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mne01008]     D174_18775 Polyketide biosynthesis proteins [BR:mne01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D174_18775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHC26483 UniProt:  V5XF74 LinkDB All DBs Position complement(3931428..3931637) Genome browser AA seq 69 aa AA seqDB search MSNNPFDDEDGAFFVLINDEEQYSLWPTFADVPAGWRVVFGESTRADCLAYVEENWNDLR PKSLRDAMS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaatccattcgatgacgaggacggcgccttcttcgtgctgatcaacgacgag gagcagtacagcctctggccgacgttcgccgatgtgcccgccggctggcgggtggtgttc ggggagagcacccgcgccgactgcctggcctatgtcgaggagaactggaacgacctgcga cccaagagcctgcgcgacgccatgtcctga

DBGET integrated database retrieval system