KEGG   Mycolicibacterium neoaurum: D174_25765Help
Entry
D174_25765        CDS       T02959                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mne  Mycolicibacterium neoaurum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AHC27746
UniProt: V5XJ12
LinkDB All DBs
Position
complement(5416394..5417446)
Genome map
AA seq 350 aa AA seqDB search
MNVVDLPVMPPLEPMLAKAQSAVPTDPGTWSYEPKWDGFRSLVFRDGDSVVLLSRSGKDL
GRYFPEVVDAVRAEITPRCVLDGEIVVPRDIAGLTRLDWESLSQRIHPAESRITKLSKET
PAHFIGFDALALGDRSLMNESFRVRREALIDAVDERDWCHVTRTTEDAGLGSQWLREFEG
AGLDGVIAKRLEGPYLPGKREMVKVKHHRDADCVAIGYRVHKSGEGIGSILLGLYRGDGD
LQMVGGAASFTAKARLSLLADLEPLRIGDDVRDGEPSRWNSAADKRWIPVRPEKVCEVAY
DQMEGNTGERRFRHAVKFVRWRPDREPSSCTFDQLDVPMNYDLRDVLETR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgtggatctaccggtcatgccgccgctggagccgatgctggcgaaggctcag
agcgcagtgcccaccgacccgggaacgtggtcctatgagcccaagtgggacggtttccga
tcgctcgttttccgtgacggtgattccgtggtgctgctgtcgcgcagcggcaaggatctg
ggccggtacttcccggaggtcgtcgacgccgtgcgcgcggagatcaccccgcggtgcgtg
ctcgacggtgagatcgtggtgccccgcgacatcgcaggactgacccggttggattgggag
tcgctcagccagcgcatccatcccgccgagagccgcatcaccaagctgtcgaaggagacc
ccggcccatttcatcggcttcgatgcgctcgccctcggcgatagatcactgatgaacgaa
tcgtttcgggtgcgtcgggaagcgctgatcgacgcggtcgacgagcgggactggtgccac
gtcacccgcaccaccgaggatgccggactcgggtcgcagtggttgcgagagttcgagggc
gccggtttggatggggtgatcgccaaacgacttgaggggccgtatctgccggggaaacgg
gagatggttaaggtcaagcatcatcgcgacgctgactgcgtggccatcggataccgcgtc
cacaagagcggtgaaggaatcggatccatcctgctgggtctctatcgcggtgacggtgac
ctccagatggtcggtggggccgcgtccttcaccgccaaggcgcggttgtcgctgttggca
gaccttgagccgctgcgcataggtgacgacgtccgcgacggtgaaccgagccgatggaac
tcggcggccgacaagcgctggatcccggtgcgcccggaaaaggtgtgcgaggtggcctac
gaccagatggagggcaacaccggcgagcgccgattccggcatgccgtgaagttcgtgcgc
tggcgtcccgaccgcgagccgtccagctgtaccttcgatcagctcgacgtcccgatgaac
tacgacctgcgcgacgtattggagacccgatga

DBGET integrated database retrieval system