KEGG   Monoraphidium neglectum: MNEG_11637Help
Entry
MNEG_11637        CDS       T05028                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mng  Monoraphidium neglectum
Pathway
mng00052  Galactose metabolism
mng00500  Starch and sucrose metabolism
mng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MNEG_11637
   00500 Starch and sucrose metabolism
    MNEG_11637
Enzymes [BR:mng01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MNEG_11637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 25728919
NCBI-ProteinID: XP_013895344
UniProt: A0A0D2LY41
LinkDB All DBs
Position
Unknown
AA seq 512 aa AA seqDB search
MAGADICGFQGDTNPELCARWISAGAFYTFTRNHNTYGAAPQELYRWPDVANAARAALRL
RYRLLPYLYSSHYGAAVWGGSVAKPLFFADPGDRAAHDASSQWLLGWSLLVSPSLSPSSN
AVQAYFPVGRWYPLEDLLAASPGVTGGGGDAGNITVVGPARQEAAAPLEAAPPLHVRGGG
VVPLQRHAPTTRAARRTPATLALALQRPAPERGSGAARRAWDEGVPPYCSGRVTARRLPG
GALAACGIWYLDDGESPEVTGPGSVLIWYTSVASSDGSSGDLTAEAARPTPAAAAAAAAA
RAATGISGKPAPTGAAPRDAAEGLTYEAVVIAGLPPLTGDGNQDGTDDDSSDGDTEEGND
GGGGEGDPGGGGDEAAGAAPEGDGEDGGDGGAAATNATAAAAPAGGAAQQPDAAGATYSV
AIGNATGPLAPVDPQSVNWDAGRGVLRISGLQLPVGAGFRLTWQPAMPPPGAAPPAVAPS
AAPPSAAPPSPALPSAAPPSAAGPRRAAPAMA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgccgacatctgcggcttccagggtgacaccaaccccgagctctgcgcacgg
tggatcagtgccggggccttctacaccttcacgcggaatcacaacacatacggcgccgcc
ccccaggagctgtaccgctggcccgatgtcgccaacgcggcgcgcgccgccctgcggctg
cggtaccgcctgctgccctacctctactcctcacactacggggcggcagtgtggggcggc
agcgtggccaagccgctgttcttcgccgacccgggcgaccgtgccgcgcacgacgcatcc
tcccaatggctgctcggctggtccctcctagtcagcccgtccctgtcccccagctcgaac
gctgtccaggcctacttcccggtgggaagatggtaccccctggaggacctcctcgcggcg
tcaccaggcgtcaccggcggcggcggtgacgccgggaacatcacggtggtcggcccggcc
aggcaggaggcggccgccccgctggaggccgcgccgccgctgcacgtccgcggcggcggg
gtcgtaccgctgcagcgccacgcgccgaccacgcgcgccgcgcggcgcacgcccgcgacg
ctcgcgctcgcgctgcagcggccggcgccggagcgcggctcgggcgcggcgcggcgcgcg
tgggacgagggcgtgccgccctactgctccggccgggtgacggcgcggcggttgccgggc
ggggcgctggccgcgtgcgggatttggtacctcgacgatggcgagtcgcccgaggttaca
gggccggggagcgtgctgatctggtacacctccgtcgcatcctcggacggctcgagcggc
gatctgactgccgaggccgcgcgcccgacgccggccgccgctgcggctgcggcggcggcg
cgggctgcgactggcatcagcgggaagccggcgccaacgggggcggcgcccagggacgcg
gcggaggggttgacgtacgaggctgtcgtcatcgccgggctgccgccgctgacgggtgac
gggaatcaggacggcaccgatgacgacagtagtgacggggacacggaggagggcaacgac
ggcggcggcggtgagggcgacccggggggcggcggtgacgaggcggccggggcggcgccg
gagggggatggtgaggacgggggcgacggcggcgccgccgcgacaaacgccacggcggca
gcggccccggcagggggcgcggcccaacaaccggatgcagccggcgcgacctattcggtg
gccatcggcaacgccaccgggcccctggcgcccgtggacccacaatctgtgaattgggac
gccggccgcggggttctgcggatctcagggttgcagctgcccgtgggggcagggttcagg
ctcacctggcagccggccatgccgccgcccggcgccgcaccgcccgccgttgcgccctct
gccgccccgccctctgctgccccgccctctcctgccctgccctctgctgccccgccctcg
gccgccgggccccggcgcgccgcgccggcgatggcttaa

DBGET integrated database retrieval system