KEGG   Monoraphidium neglectum: MNEG_13394Help
Entry
MNEG_13394        CDS       T05028                                 

Definition
(RefSeq) putative DNA repair protein UVH3
  KO
K10846  DNA excision repair protein ERCC-5
Organism
mng  Monoraphidium neglectum
Pathway
mng03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mng00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    MNEG_13394
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mng03400]
    MNEG_13394
DNA repair and recombination proteins [BR:mng03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     MNEG_13394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I
Motif
Other DBs
NCBI-GeneID: 25730852
NCBI-ProteinID: XP_013893587
UniProt: A0A0D2J3R8
LinkDB All DBs
Position
Unknown
AA seq 1328 aa AA seqDB search
MAGDASRHGAGASFLVDAADRDGGGGGGGRRRRKAGSSQLAELEASGALSERRVGGPAAR
LPAVIGQVRLAAFQSVFREHEQLRRKEADLLALADGGEAGGGGHAGDGADGGREREGSEE
KDGVRGGGVGGLFPAPAGWLGPATQQLPAPTHAAVVVKEEVIDGPAPADADGFADTPPGA
ARRRSSDGPGGGGGSGGEAVRIEVVLPMGAASSSDGEAMEIDPEDAALFGSGDGSDVSGD
EGRQRGAGAPLGGRQVPAAMNVGGGGGGGGVLETKLRSIEQAAAAGPGGKDEEEEWEEVA
PGGASGAGGAGSGGAGVEGQLPQWRQRMMQRHRFWSTSHGFRMGRKLGDWAAAEQAGAPA
AAVARGAAPAAALVAGRSPVKQGGARSGRGGAAAGGRGAADEGDEAEDADLMRAIALSLE
SAGGANGHDSGGGGAIGGATAAAELAAEGEEDEEEWEDRPLPLQQQQQQQQQQQQQQQQQ
QQFKNSEVEARPGASQDISADEGGQRTTGGARVVDEGEEEWAQEWGRISSGIMESDDAAR
RVGQLVQPLGVRAHHQHLPEQQQQQQQQQPEPPEQHLELWEQQEQQDRQQGLVANGHSAL
LEGVPPASAAALISRLNRHSEALLEADPGVEARGAERLGSLHRQLAAAAAGGAAPSARAP
DALGAAALGKAALGELGAGGSGGGASGADGSVVGSAGALAEGGAEGGRAPGQPSAQAELV
GRPPSQQQQQQQQGVVTGIRAPRVSEDDFSFVLEAPAAAEATLAKAASSRPLLPNASVAV
RAAGPHLQDLPGQEDGSFYAPTVADDHPGGGAAVGPSAEVEPALALAPVQEAAAADGVGE
GGHAEVERWSTERQQAQLGKKDEEQQEQQQPEQQQQEQQQQEQQQEKQQEKQQEQQQQQV
QQEQQPLEQQGEQPFKAAARKRVRFAPRSAAPQPAAEAQVLGGSESSAAAAPDSPPTSAR
QPQAQHTADAEVTDAIEPHSQQQQPQQLLLPMPQAEVPKSAAVPAQQQQHPPQPQQQQQQ
QQQQQAPPPQIDLEAELEALDAQDASLRAQQRKAARSAEAPTADMYAECQELLRLFGLPY
IVAPVEAEAQCAWLEGAGLVDGTVTDDNDVFLFGGRHVYRHLFDDKKYVEEFHMSDVERE
LGLGREALVTLALLLGSDYTEGCQGVGIVNAVEVVHAFPGLDGLARFKDWVRAPDVRGLL
EDARAKAAGKAAARGRGRGRRKGGKGGEGAEGAEGQQEQDEQQQQQEQRQSQGEQQEGQE
QEPEQPGGLSADQRVFFAAHAGVRRNWQVPATFPSPAVVAAYLDPRVDPNKARFSFGRPD
HEALREFC
NT seq 3986 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgacgcctcccgccacggcgccggcgccagcttcctggtcgatgccgccgac
cgcgacggcggcggcggcggcgggggccgccggcgccgcaaggcggggtcgagccagctg
gcggagctggaggcgagcggagccctcagcgagcggcgcgtcgggggccccgcggcgcgc
ctgccggccgtaataggccaggtgcggctggccgccttccagtcggtgttccgcgagcac
gagcagctgaggcggaaagaggctgacctcctcgcgctcgcagacggcggggaggcaggg
ggcggcgggcacgccggcgacggcgccgacggcggccgcgagagggagggatccgaggag
aaggacggggttcgcggtggcggcgtcggcggcctgtttccggcgcccgcggggtggctt
gggcccgccacgcagcagcttccggcgccgacgcacgccgcggtggtcgtgaaagaggag
gtgatcgacggccccgcgcccgccgatgccgatggctttgcagacacgccgccgggcgcc
gcgcgccgccgcagcagcgacggcccgggcggtgggggcggcagcggcggcgaggcggta
cggattgaggtcgtgctgccgatgggcgcggcatcatcgtcggatggtgaggcgatggag
attgaccccgaggacgcagccttgtttggcagcggcgacggcagcgacgtcagcggcgac
gagggccggcaacgaggggctggcgcgcccctcggcgggcgccaggtcccagcagccatg
aacgtcggcggcggcggcggcggtggcggtgttttagagacgaaacttcgaagcatcgag
caggcggcggccgcggggccgggtggcaaggacgaggaggaggagtgggaggaggtcgcg
cccggcggcgcttccggcgccggcggcgccggcagcggcggcgcgggcgtcgaggggcag
ctgccgcagtggaggcagcggatgatgcagcgccacaggttctggtccacttctcacggc
ttcaggatgggccgcaagctcggcgactgggcggccgcggagcaagccggcgcgcccgcc
gccgccgtcgcgcgcggcgcggcgccggccgcggcgctcgtcgccgggcggtcgcctgtg
aagcagggcggggcgcgttcgggccgcgggggcgcggcggcgggcgggcgcggggcggcg
gacgagggggacgaggcggaggatgcggacctgatgcgcgcgatcgctctcagcctggag
agcgcgggcggcgccaacggccacgactccggcggtggaggcgcgatcggcggagcaact
gcagctgcagagctggcggcggagggggaggaggacgaggaggagtgggaggatcggccg
cttccactgcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcag
caacaattcaaaaacagcgaggttgaagcgcgacctggtgcatcacaggacatatccgcc
gacgaggggggccagcgcaccacaggaggcgcccgagtggtggatgaaggcgaggaagag
tgggcgcaggagtgggggcgcatcagcagcggcatcatggaaagtgatgacgcggcccga
cgggtcgggcagcttgtgcagccgcttggcgtgcgagcgcatcaccaacatttgccggag
cagcagcagcagcaacagcagcagcagccggagccgccggagcagcacctggagctgtgg
gagcagcaggagcagcaggaccggcagcaggggttggtcgccaacggccactcggcgctg
ctggaaggggtcccccctgcctcggcagctgcgctgatatcgcggctcaacaggcacagc
gaggcgctgctagaggcggacccaggggtagaggcgcgcggggcggagcgcctgggcagc
ttgcacaggcagctggcggcggcagcggccggcggcgcggcgccgtcggcgcgggcgccg
gacgccctaggtgcggcggcgctaggaaaggcggcgctcggggagctgggggcagggggc
agcggcgggggagcaagtggggctgatggcagcgtggttggctcggcaggtgccctggcc
gagggcggtgcggagggcggccgcgcgcccgggcagccgtcggcgcaggctgagctggtg
ggacggccgccatctcagcagcagcagcagcagcagcagggcgtggtgaccggcatcagg
gcgccgcgcgtcagcgaggacgacttcagcttcgtgctcgaggctccggccgcagcggag
gccacgcttgcgaaggccgccagctctcgccccttgttaccaaatgccagcgtggcggtg
cgcgcggcaggcccccatctgcaggatctacctgggcaggaggatggctctttctatgcg
cccacggtcgccgacgaccacccagggggcggcgccgctgttgggccatcagccgaggtt
gagcctgccctggctttggcgcctgtgcaggaggcagcggcagcagatggggttggtgag
ggtgggcatgcggaggtggagcgttggagcactgagcggcaacaggctcagcttggcaag
aaggacgaggagcagcaggagcagcagcagccggagcagcagcagcaggagcagcagcag
caggagcagcagcaggagaagcagcaggagaagcagcaggaacagcagcagcagcaagtg
cagcaagagcagcaaccccttgagcagcaaggggagcaacccttcaaagcagcggcacgc
aagcgcgtcagatttgcacctcgcagcgctgcaccacagcctgcagccgaggcccaggtt
ctcggcggctcagagtcgagcgccgccgcggctcctgattcgccgcccacgtctgctcgt
cagccgcaggcgcaacatactgctgacgcggaggtcacggatgccatagaaccgcattcg
cagcagcaacagccccaacagctgctgctgccgatgccgcaggccgaggtgccgaaatct
gcggcggtgccggcccagcagcagcagcatccgccgcagccgcagcagcagcagcagcag
cagcagcagcagcaggcgccgcccccccagatcgatctggaggccgagctggaggcactc
gatgctcaagacgcctccctgcgcgcgcagcagcgcaaggcggcgcgctccgccgaggcg
ccgaccgccgacatgtacgccgagtgccaggagctgctgcggctgttcggcctgccctac
atcgtggcgccggtggaggcggaggcgcagtgcgcgtggctggagggggcggggctggtg
gacgggacggtgacggacgataacgacgtgttcctgttcggggggcggcacgtgtacagg
cacctgttcgacgacaaaaagtatgtcgaggagttccacatgtctgacgtggagcgggag
ctgggcctgggcagggaggccctcgtcacgctggcgctgctgctgggcagcgactacaca
gagggctgccagggtgtgggcatcgtcaatgcagtggaggtggtccacgccttcccgggc
ctggacggcctcgcccgcttcaaagactgggtgcgcgcgccagacgtgcgcggcctgctg
gaggacgcgcgcgccaaggcggcaggcaaggcggccgcgcgggggcgcggtcgcgggcgg
cgcaaaggcggcaagggcggcgagggggcggagggagcggaggggcagcaggagcaggac
gagcagcagcagcaacaggagcagcggcagtcgcagggtgagcagcaggaggggcaggag
caggagccggagcagcccggcggcctcagcgccgaccagagggtcttcttcgccgcccac
gcgggcgtgcggcgcaactggcaggtgcccgcgaccttcccctcgccggcggtggtggcg
gcctacctggacccgcgggtcgaccccaacaaggcgcgcttcagcttcgggcggcccgac
catgaggcgctgcgcgagttctgctg

DBGET integrated database retrieval system