KEGG   Monoraphidium neglectum: MNEG_13866Help
Entry
MNEG_13866        CDS       T05028                                 

Definition
(RefSeq) xylose isomerase
Organism
mng  Monoraphidium neglectum
SSDB OrthologParalogGFIT
Motif
Pfam: AP_endonuc_2 Telomere_Sde2_2
Motif
Other DBs
NCBI-GeneID: 25731371
NCBI-ProteinID: XP_013893117
UniProt: A0A0D2J283
LinkDB All DBs
Position
Unknown
AA seq 420 aa AA seqDB search
MAARRDLADSAAAHGGGAGLGSRGGGGDGVLGWVARQGLVEGLGLVYFNYPQHLEGMDPD
EVKRALSTAGLAAGGVALRFPGRFRAGALTNPDAALRAEALALALGACGWARDLGASEVV
VWSAFDGYDYHMQGRGERQRAAPGGASGTPLIARPPAGPQRSAAQQCRRLAALADAGATW
RDLMHARSSADYDLAWRRLAEGLSALADGCGPRVNVSLEWKPTDPSSRFSFVPSTAAALL
LAREVNRPSFGLTLDTGHMLMAGENPAHSAAMVAAAGKLFGMHLNDGHSRVGAEDGLIFG
SVHPAAALELVYWLRRVGYGGAVYFDTFPVNEDPVREAELNIRRFKQLWARAAQLDEAGI
AAALLRHDSLGAMGLIDQEGVTGAAGPLQALAAASSGGPRALNRGVQSNTAEATVSRDEL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcggcgggacttggcggattcggcagcggcgcacggcggcggcgccggccta
ggcagtcgcggcggcggcggcgacggcgtcctgggttgggtggcgcggcaggggctggtg
gaggggctgggcctggtctacttcaattacccgcagcacctggaggggatggacccggac
gaggtcaagcgggccctgtccaccgctggcctcgccgccggtggcgtcgcgctccgcttc
cccggccgcttccgcgccggcgcgctgacaaacccggacgcggctctgagggcggaggcg
ctcgcgctcgcgctgggcgcgtgcggctgggcgcgcgacctgggggcgtccgaggttgtc
gtgtggtcggcgttcgacggctacgattaccacatgcaggggcggggagagcgccagcga
gcagcgccaggcggcgccagcggcacgcccctcatagcccgcccgccggccggcccgcag
cgcagcgcagcgcagcagtgccggcggctggcagccctggccgacgcaggcgccacgtgg
cgcgacctcatgcatgcccgcagctcagcggattacgacctggcatggcgccgcctggcc
gaggggctctctgcgctagcggacggctgcgggccgcgcgtcaacgtgtcgctggagtgg
aagccgacagaccccagcagccgcttctcgttcgtgccgtccacagcggcggcgctgctg
ctcgcgcgggaggtaaaccgaccaagctttggcctgacccttgacaccggccacatgctc
atggcgggagagaaccccgcccacagcgccgctatggtggcagctgccgggaagctgttt
gggatgcacctgaacgacggccactcgcgcgtcggcgcagaggacgggctgatatttggg
tcggtgcaccctgcggcggccctggagctcgtgtactggctgcggcgggtggggtacggc
ggggcggtctactttgacaccttccccgtcaacgaggacccggtgcgtgaggcggagctc
aatatccggcgcttcaagcagctgtgggcacgtgccgcgcaactggacgaggccggcatc
gcagccgcgctgctgcgccacgactcgctcggcgcgatgggcctgattgatcaggagggg
gtcacgggcgctgcggggccgctgcaagcattggctgcagccagcagcggcggaccgagg
gccttgaatcggggcgtgcagagcaacaccgcggaggctacagtcagcagagacgagctg
tga

DBGET integrated database retrieval system