KEGG   Monoraphidium neglectum: MNEG_15042Help
Entry
MNEG_15042        CDS       T05028                                 

Definition
(RefSeq) succinate dehydrogenase (ubiquinone)flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mng  Monoraphidium neglectum
Pathway
mng00020  Citrate cycle (TCA cycle)
mng00190  Oxidative phosphorylation
mng01100  Metabolic pathways
mng01110  Biosynthesis of secondary metabolites
mng01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MNEG_15042
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MNEG_15042
Enzymes [BR:mng01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MNEG_15042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 FAD_binding_3 Pyr_redox_2 Thi4 GIDA HI0933_like Lycopene_cycl Pyr_redox_3 Ribosomal_S11
Motif
Other DBs
NCBI-GeneID: 25732664
NCBI-ProteinID: XP_013891941
UniProt: A0A0D2LT46
LinkDB All DBs
Position
Unknown
AA seq 244 aa AA seqDB search
MLSKLLISACGGPGAAALLPASQRIMAGLMGAPAANKGAAATGSERQQQRRRGYASASAA
NAATKSYPMIDHQYDAIVVGAGGAGLRAAVGLSEAGLKTACITKLFPTRSHTVAAQGGIN
AALGNMSVDDWRWHAYDTIKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTDDGKI
YQRAFGGQSLDYGKGGQAYRCACAADRTGHAMLHTLYGMAMKFNIQFFGGGVWGWRRDAG
VGVC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctaagctacttatatcggcctgcggcggccctggcgccgccgcgctgctgcct
gcgagccagcgcatcatggctgggctgatgggtgcgccggccgccaacaagggcgcggcg
gccacaggctcagagcgccagcagcagcggcggcgaggctacgcgtcggcttccgcggcc
aacgccgccaccaaatcgtaccccatgatcgaccaccaatacgacgcgatcgtggtcggc
gcgggcggcgcggggctgcgggcggcagtgggcctgtcagaggcgggcctcaagacagcg
tgcatcaccaagctgttcccgacccgcagccacacggtggcggcccagggcggcatcaac
gcggcgctgggcaacatgtccgtggacgactggcgctggcatgcgtatgacactatcaag
ggcagcgactggctgggggaccaggacgccatccagtacatgtgccgcgaggcccccaag
gccgtgatagagctggagaactacggcctgcccttcagccgcacagacgacggcaagatc
taccaaagggccttcggggggcagtccctggactacggcaagggggggcaggcgtaccgc
tgcgcgtgtgccgcggaccgcaccgggcatgcgatgctgcacaccctctacggcatggcc
atgaagttcaacatccagttcttcggtgggggggtttggggatggcggagggatgcaggg
gtgggggtgtgttag

DBGET integrated database retrieval system