KEGG   Monoraphidium neglectum: MNEG_3239Help
Entry
MNEG_3239         CDS       T05028                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mng  Monoraphidium neglectum
Pathway
mng00480  Glutathione metabolism
mng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mng00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MNEG_3239
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mng02000]
    MNEG_3239
Enzymes [BR:mng01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MNEG_3239
Transporters [BR:mng02000]
 Other transporters
  Pores ion channels [TC:1]
   MNEG_3239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_2 GST_C_5 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 25736117
NCBI-ProteinID: XP_013903739
UniProt: A0A0D2MPY9
LinkDB All DBs
Position
Unknown
AA seq 245 aa AA seqDB search
MATEVLSKGSTQPELGTFDAPTFITTWNCPYAQRTWIALNEKGVKYNRVFVDLKEKPEWF
FPLNPYGRVPTLAWKDGRGTHSLYESLICNEFVEDAFEGPSLLPEDPVQRAQVRLLIDQF
GAKVGPAFGKAIFASEDEAPAAGKALGEALTWLDSALDPTGPYAAGANFTLADAALTPFV
IRVSLLQGLIGYKVPEGLDRVKAWQAVVLDRQSVKDSIVPPDPSKGWEEQLLESYRAYLA
SRRAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggccacggaggtgctttcaaagggctctacacagccagaactgggcacatttgacgcg
ccgacgttcatcacgacgtggaactgcccttatgctcagcgcacctggattgccctgaac
gagaagggggtcaagtacaaccgcgtttttgtagacctcaaggagaagcctgagtggttc
ttccccctcaacccctatggccgcgtgcccaccctggcctggaaggacggccgcggcacg
cacagcctgtacgagagcctgatctgcaacgagtttgtggaggacgcgtttgagggcccc
agcctgctgccggaggacccagtgcagcgcgcgcaggtcaggctgcttattgaccagttc
ggggccaaggtcgggccggcgtttgggaaggcgatttttgcttcagaggatgaggcgccc
gcggccggcaaagccctcggggaggcgctgacgtggctggactccgccctcgaccccacc
ggcccctacgccgccggcgcgaacttcacgctcgccgacgcggcgctgacgccgttcgtc
atccgcgtgtcgctgctccagggcctgatcggttacaaggtgcccgaggggctggacagg
gtcaaggcgtggcaggctgtagtgcttgaccggcagagcgtgaaggacagcatcgtaccg
ccggaccccagcaagggatgggaggagcagctgctcgagtcgtaccgcgcgtacctggcg
tcccgcagggcggcatga

DBGET integrated database retrieval system