Monoraphidium neglectum: MNEG_5381 Help Entry MNEG_5381         CDS       T05028                                  Name (RefSeq) thioredoxin x   KO K03671   thioredoxin Organism mng  Monoraphidium neglectum Brite KEGG Orthology (KO) [BR:mng00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mng03110]     MNEG_5381 Chaperones and folding catalysts [BR:mng03110]  Protein folding catalysts   Protein disulfide isomerase    MNEG_5381 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_6 Thioredoxin_3 Motif Other DBs NCBI-GeneID:  25738258 NCBI-ProteinID:  XP_013901599 UniProt:  A0A0D2MHQ0 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MDWAEQEYGGSFKVVKVNHTPNPNIIAKYKVYGLPTLMVFKDGELVEDSHREGAFTKAIL KKYIEDHILATVNA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggattgggcggagcaggagtatggcggcagcttcaaggtggtgaaggtcaaccacaca cccaaccccaacatcattgctaaatataaggtgtatggcctgcccaccctgatggtgttc aaggatggggagttggtcgaggacagccaccgcgagggggccttcaccaaggccattctc aaaaagtacatcgaggaccacatcctcgccactgtcaacgcgtga

DBGET integrated database retrieval system