KEGG   Methylobacterium nodulans: Mnod_0682Help
Entry
Mnod_0682         CDS       T00839                                 

Definition
(GenBank) enoyl-acyl carrier protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mno  Methylobacterium nodulans
Pathway
mno00061  Fatty acid biosynthesis
mno00780  Biotin metabolism
mno01100  Metabolic pathways
mno01130  Biosynthesis of antibiotics
mno01212  Fatty acid metabolism
Module
mno_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mnod_0682
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mnod_0682
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Mnod_0682
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mno01004]
    Mnod_0682
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Mnod_0682
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Mnod_0682
Lipid biosynthesis proteins [BR:mno01004]
 Fatty acid synthase
  Component type
   Mnod_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACL55714
UniProt: B8IF03
LinkDB All DBs
Position
complement(746924..747784)
Genome map
AA seq 286 aa AA seqDB search
MADTNRAQVEDYEQAAGPRTGLLAGKRGLVLGVANNRSIAWGIARSARQHGADLAFTYQG
EALRKRVEPLARELDAAVVGHCDVTDPASIDAVFAEAGRHFGGGLDFVVHCIAFSDKDEL
TGRYIETSEANFTKSLLISCYSFTAIAQRAEKLMKDGGSLLTLTYYGAEKWMPHYNVMGV
AKAALEASVRYLAADLGPSKIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVT
IEEVGETASYLVSDMSRGMTGEILHVDAGYHVVGMKNPEAPDLSKE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcggatacgaaccgggctcaggtcgaggattacgagcaggccgcaggcccgaggacc
gggcttttggcgggcaagcgcggcctcgtgctgggggtcgccaataaccgctcgatcgcc
tgggggatcgcccgcagcgcccggcagcacggggccgacctcgctttcacctatcagggc
gaggccctgaggaagcgggtcgagccgctggccagggaactcgacgcggcggtggtcggc
cattgcgacgtcaccgacccggcctcgatcgacgcggtctttgccgaggcgggccgccat
ttcggcggcggcctcgatttcgtcgtccactgcattgccttctcggacaaggacgagctg
accggccgctacatcgagaccagcgaggcgaacttcaccaagtcgctcctcatctcctgc
tactcgttcacggcgatcgcccagcgggccgagaagctgatgaaggacggcggctcgctg
ctcaccctgacctattacggtgccgagaagtggatgccccactacaacgtgatgggcgtc
gccaaggccgcgctggaagcctccgtgcgctatctcgcggccgatctcggcccctcgaag
atccgggtcaacgccatctcggccggcccgatcaagacgctggccgcctccggcatcggc
gatttccgctacatcctgaagtggaacgaatacaacgcgccgctgcgccggacggtgacc
atcgaggaggtgggcgagacggcctcctacctcgtctccgacatgtcgcggggcatgacc
ggcgagatcctgcacgtcgatgcgggctaccacgtcgtcggcatgaagaatcccgaggcg
cccgacctgagcaaggagtga

DBGET integrated database retrieval system