KEGG   Methylobacterium nodulans: Mnod_1541Help
Entry
Mnod_1541         CDS       T00839                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mno  Methylobacterium nodulans
Pathway
mno03030  DNA replication
mno03410  Base excision repair
mno03420  Nucleotide excision repair
mno03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mno00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mnod_1541
   03410 Base excision repair
    Mnod_1541
   03420 Nucleotide excision repair
    Mnod_1541
   03430 Mismatch repair
    Mnod_1541
Enzymes [BR:mno01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mnod_1541
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mnod_1541
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mnod_1541
DNA replication proteins [BR:mno03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mnod_1541
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mnod_1541
DNA repair and recombination proteins [BR:mno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mnod_1541
   NER (nucleotide excision repair)
    Other NER factors
     Mnod_1541
   MMR (mismatch exicision repair)
    Other MMR factors
     Mnod_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: ACL56533
UniProt: B8INK7
LinkDB All DBs
Position
1628561..1630273
Genome map
AA seq 570 aa AA seqDB search
MNDFAHLLDRLAYEPRRSAKLRLLQDFFAHTPDPDRGFALAAMTGSLSFREAKPGLIRGL
VEERVDPVLFRMSYHYVGDLAETTALIWPAPEAAAPDAAGSGHNNPPPHVPSLGEVVEAL
ATIGKGELPSRLAGWLDRLDETGRWALIKLITGELRVGVSARLAKTAVASLGGFEADAVE
EVWHGLKAPYRALFAWVEGRAERPETLNPAPFRPPMLSHPVDEETDFGKLDPAAFCAEWK
WDGIRVQLVGGRDRAGDQVARIYSRTGEDISGAFPDLAAAIGFTGALDGELLILREGRVQ
SFNVLQQRLNRKAVTPKLLQDFPAHVRAYDLLALDGEDLRALPFAERRARLEAFVRGLDH
ARIDLSPLVPFGDWEELAAARADPASVGAGEDAEAIEGVMLKRRTSAYVPGRPKGPWWKW
KREPYRVDAVMMYAQRGHGKRSSFFSDYTFGVWRDSPEGGEELVPVGKAYHGFTDEELAK
LDRYVRNHTVKRFGPVREVEYGLAKGLVLEIAFEGLQRSTRHKSGVAMRFPRVSRVRWDK
PPAEADRLERLHEILERGEREVMPGREMVP
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacttcgcccacctcctcgaccgcctcgcctacgagccgcgccgcagcgccaag
ctgcggctcctgcaggacttcttcgcgcatacgccggacccggaccgcggcttcgcgctc
gccgccatgaccggctccttaagcttccgcgaggcgaagcccggcctgatccgcggcctc
gtggaggaaagggtcgatccggtcctgttccggatgtcctaccattatgtcggcgacctc
gccgagacgaccgccctgatctggccggcgccggaggccgccgcccccgatgccgcggga
agcggccacaacaacccgccgcctcacgtgccgagcctcggcgaggtcgtcgaggcgctg
gcgaccatcggcaagggcgagttgccttcccgcctcgccgggtggctcgacaggctcgac
gagaccgggcggtgggcgctcatcaagctcatcaccggcgaattgcgggtcggcgtctcg
gcccgcctcgccaagaccgcggtcgcgagcctcggcggcttcgaggccgacgccgtcgag
gaggtctggcacgggctgaaggccccctatcgggcgctcttcgcctgggtggagggaagg
gccgagcggcccgagaccctcaaccccgccccgttccggccgccgatgctctcgcatccg
gtcgacgaggagaccgacttcggcaagctcgaccccgcagccttctgcgccgagtggaag
tgggacggcatccgggtgcagctcgtcggcgggcgcgaccgggccggcgatcaggtcgcg
cgcatctactcgcgcaccggcgaggacatctcgggcgccttcccggacctcgctgcggcg
atcggcttcacgggggcgctcgacggcgagcttctgatcctgcgcgagggccgggtgcag
agcttcaacgttctccagcagcgcctcaaccggaaggccgtgacgccgaagctgctgcag
gactttcccgcgcatgtccgcgcctacgatctcctcgccctcgacggggaggatctgcgc
gcgctgcccttcgcggagcgccgcgcgcggctggaagccttcgtgcgcggcctcgaccat
gcccggatcgacctctcgcccctcgtgcccttcggcgactgggaggaactggccgccgcc
cgcgccgatccggcgagcgtcggggcgggcgaggatgccgaggcgatcgagggcgtgatg
ctcaagcgccgcaccagcgcctatgtgccgggccggccgaaggggccgtggtggaagtgg
aagcgcgagccctaccgggtcgatgcggtgatgatgtacgcccagcgcggccacgggaag
cgctcctccttcttttccgactacacgttcggggtctggcgcgattccccggaaggcggc
gaggagctggtcccggtcggcaaggcctatcacggcttcaccgacgaggaactggccaag
ctcgaccgctacgtccgcaaccacacggtcaagcgcttcggcccggtccgcgaggtcgag
tacgggcttgccaaggggctggtcctggagattgccttcgaggggctgcagcgctcgacc
cggcacaagtcgggcgtggcgatgcgctttccccgcgtgagccgggtccgctgggacaag
ccgcccgccgaggccgaccggctcgagaggctgcacgagatcctggagcgcggcgagcgc
gaggtgatgccgggacgggagatggtgccatga

DBGET integrated database retrieval system