KEGG   Methylobacterium nodulans: Mnod_1585Help
Entry
Mnod_1585         CDS       T00839                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mno  Methylobacterium nodulans
Pathway
mno00010  Glycolysis / Gluconeogenesis
mno00620  Pyruvate metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_1585
   00620 Pyruvate metabolism
    Mnod_1585
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mnod_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Acetyltransf_6 OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ACL56575
UniProt: B8IPS5
LinkDB All DBs
Position
complement(1661691..1663211)
Genome map
AA seq 506 aa AA seqDB search
MNKPEFLHGTTASPFSARYDNFIGGQWVAPAGGRYFENTSPLTGRVICEVARSDAQDIER
ALDAAHAAKEAWGHTAPAERARILNRMADRMEENLELLALAETWDNGKPIRETTHADIPL
AIDHFRYFAGCIRAQEGSLSEIDQDTVAYHFHEPLGVVGQIIPWNFPLLMAVWKLAPALA
AGNCVVLKPAEQTPASVLVLAEIVGDLLPAGVLNIVNGFGLEAGKPLASSPRIAKIAFTG
ETSTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVLAEDDAFLDKALEGFTMFALNQGEV
CTCPSRALVHEAIYDRFIEKAVARVNAIKQGSPLDPATMIGAQASGEQLQKILSYIDIGK
QEGAQLLTGGERNRLEGEFAQGFYVKPTVFKGHNRMRIFQEEIFGPVLSVTTFKDDEEAL
AIANDTLYGLGAGVWTRDITRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNMLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgaattcctgcacggcacgacggcctcgccgttctccgcgcgctacgac
aacttcatcggcggccagtgggtggcgccggccggcggccgctacttcgagaacacgtcg
ccgctcaccggccgggtgatctgcgaggtggcccgctccgacgcgcaggacatcgagcgg
gcgctcgatgccgcgcacgccgccaaggaggcctggggccacaccgcgccggccgagcgc
gcccgcatcctcaacaggatggccgaccgcatggaggagaacctcgaactcctcgcgctc
gccgagacctgggacaacggcaagccgatccgcgagaccacccacgccgacatcccgctc
gccatcgaccatttccgctacttcgcgggctgcatccgcgcgcaggagggctcgctctcc
gagatcgaccaggacacggtcgcctaccacttccacgagccgctcggcgtggtcggccag
atcatcccgtggaacttccccctgctgatggcggtgtggaagctcgcccccgcgctggcg
gccggcaactgcgtggtgctcaagccggccgagcagaccccggcctcggtgctggtgctg
gccgagatcgtcggcgacctgctgccggccggggtgctcaacatcgtcaacggcttcggg
ctggaggccggcaagccgctcgcctcctcgccgcggatcgccaagatcgccttcacgggc
gagacctcgaccggccggctgatcatgcagtatgccagccagaacctgatcccggtcacg
ctggagctgggcggcaagtcgccgaacatcttcttcaaggacgtgctggccgaggacgac
gccttcctggacaaggcgctggagggcttcacgatgttcgccctcaaccagggcgaggtc
tgcacctgccccagccgggcgctggtgcacgaagcgatctacgaccgcttcatcgagaag
gcggtcgcccgcgtgaacgccatcaagcagggctcgccgctcgatcccgccacgatgatc
ggcgcccaggcctcgggcgagcagctccagaagatcctgtcctacatcgacatcggcaag
caggagggcgcgcagcttctcaccggcggcgagcgcaaccggctggagggcgagttcgcg
caaggcttctatgtgaagccgacggtgttcaagggccacaaccggatgcggatcttccag
gaggagatttttgggccggtgctgtcggtgacgaccttcaaggacgacgaggaggcgctg
gcgatcgccaacgacacgctctacgggctcggggccggcgtgtggacccgcgacatcacc
cgggcctaccgcttcggccgggcgatccaggccggccgcgtctggacgaactgctaccac
gcctatccggctcacgcggccttcggcggctacaagcagtccggcatcggccgtgagaac
cacaggatgatgctcgaccactatcagcagaccaagaacatgctggtcagctactcgccc
aaggcgctcgggttcttctga

DBGET integrated database retrieval system